DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULIL (50S ribosomal protein L15e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHK 528
            R R  E+R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  + +AEERA RK   L VL SY++ ED  YKY+E+I+VDP+H  I+NDP   WL +P +++R  RGLTSAGKK RGLR     KG + HK
Sbjct:   24 RQRFIEWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYGPAKGYKWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIIMVDPSHPVIKNDPNYKWLQDPSNRNRVFRGLTSAGKKARGLRKSKGFKGTVKHK 185          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULIK (50S ribosomal protein L15e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHK 528
            R R  E+R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  + +AEERA RK   L VL SY++ ED  YKY+E+I+VDP+H  I+NDP   WL +P +++R  RGLTSAGKK RGLR     KG + HK
Sbjct:   24 RQRFIEWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYGPAKGYKWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIIMVDPSHPVIKNDPNYKWLQDPSNRNRVFRGLTSAGKKARGLRKSKGFKGTVKHK 185          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULIA (50S ribosomal protein L15e OS=Sulfolobus islandicus (strain M.16.27) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.016e-29
Identity = 74/165 (44.85%), Postives = 96/165 (58.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRG----KGHLHHK 528
            R R  E+R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  + +AEERA RK   L VL SY++ ED  YKY+E+I+VDP+H  I+NDP   WL +P +++R  RGLTSAGKK RGLR     KG + HK
Sbjct:   24 RQRFIEWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYGPAKGYKWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIIMVDPSHPVIKNDPNYKWLQDPSNRNRVFRGLTSAGKKARGLRKSKGFKGTVKHK 185          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_ARCFU (50S ribosomal protein L15e OS=Archaeoglobus fulgidus GN=rpl15e PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.332e-28
Identity = 72/175 (41.14%), Postives = 102/175 (58.29%), Query Frame = 1
Query:   55 RCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX------KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKR 561
            R  ++R+ P++VR+ RPTR D+AR LGYKAK+                         KG++  + T +        ++ + +AEERA RK   + VLNSYW+ ED  YK+FEVILVD  H AI++DP+++W+     + R  RGLTSAG+K RGLR KG    K RPS RA +++
Sbjct:   27 RLQKWRREPAVVRIPRPTRLDRARALGYKAKKGIIVVRVRIRRGGRRATRPNKGRKSKGLMVNRRTPK--------KNLQWIAEERANRKYPNMEVLNSYWVGEDGRYKWFEVILVDRDHPAIKSDPQLSWVSRT--RGRVYRGLTSAGRKARGLRRKGRGAEKVRPSLRANFRK 191          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_META3 (50S ribosomal protein L15e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.046e-28
Identity = 73/181 (40.33%), Postives = 97/181 (53.59%), Query Frame = 1
Query:   16 KKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK 558
            K     ++ LQ  R  ++R+ P++VRV +PTR D+AR LGYKAKQ                   K     KP    + ++   +S + +AEERA ++   L VLNSY + ED   K++EVIL+D  H +I+ND     LC   H +R  RGLTSAGKK RGL  KG    K RP  RA  K
Sbjct:   13 KPSESYVKGLQWARMQDWRKEPTVVRVEKPTRIDRARSLGYKAKQGVIVARVAVRRGGLRKPRPKHSK--KPATMAMNKITMSKSIQRIAEERAAKRYPNLEVLNSYSVGEDGKRKWYEVILIDVNHPSIKNDSSYKNLCTGKHTNRVFRGLTSAGKKGRGLMNKGKGAEKVRPGIRANKK 191          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULTO (50S ribosomal protein L15e OS=Sulfolobus tokodaii GN=rpl15e PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.196e-28
Identity = 71/173 (41.04%), Postives = 98/173 (56.65%), Query Frame = 1
Query:   22 QSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL---RG-KGHLHHK 528
            QSD  + + R R  E+R+ P++ R+ +PTR ++AR +GYKAKQ                         +P   GV      +  R +AEE+A RK   L VL SY++ ED  YKY+E+I+VDP H  I++DP + WL +P ++ R  RGLTSAGKK RGL   RG KG + HK
Sbjct:   14 QSDEWKKVLRQRLIEWRKSPAVERIDKPTRLNRARAIGYKAKQGFVVVRVRVRRGGLNKPRPNS--GRRPKRMGVYGYSPAKGYRWIAEEKAARKFPNLEVLGSYYVGEDGMYKYYEIIMVDPNHPVIKSDPNLKWLQDPANRKRVFRGLTSAGKKARGLLKSRGLKGTVKHK 184          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_SULSO (50S ribosomal protein L15e OS=Sulfolobus solfataricus GN=rpl15e PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.786e-28
Identity = 68/153 (44.44%), Postives = 92/153 (60.13%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLR 504
            R R  ++R+ PSIVR+ +PTR ++AR LGYKAKQ                    KG    +P   GV      +  R +AEERA RK   L VL SY++ ED  YKY+E+++VDP+H  I++DP+  WL +P +++R  RGLTSAGKK RGLR
Sbjct:   24 RQRLIKWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKG---RRPKRMGVYGYSPAKGYRWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIVMVDPSHPVIKSDPKHKWLQDPSNRNRVFRGLTSAGKKVRGLR 173          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METAC (50S ribosomal protein L15e OS=Methanosarcina acetivorans GN=rpl15e PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.786e-28
Identity = 73/175 (41.71%), Postives = 100/175 (57.14%), Query Frame = 1
Query:   46 QRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRS-------VAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +R++ W  R+  S+ R+ RPTR D+AR LGYKAKQ                    G+ + +P N+G    K  ++K S       +AE RA R+   L VLNSYW+ ED  +K+FEVILVDP H  I++D  +NW+C+P  + R  RG TSAG+K RG+  +G    K RPS RA
Sbjct:   27 ERLQVW--RKQGSVTRIERPTRIDRARSLGYKAKQGIVVVRVNVRRG--------GLGHVRP-NRGRRTQKMGKNKVSGGMSIQRIAEVRADRRYPNLEVLNSYWVGEDGKHKWFEVILVDPHHPVIKSDKNLNWVCDPSSRGRATRGKTSAGRKGRGMATRGKGTEKTRPSIRA 190          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METS5 (50S ribosomal protein L15e OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.863e-28
Identity = 74/178 (41.57%), Postives = 100/178 (56.18%), Query Frame = 1
Query:   49 RVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGL---RG-KGHLHHK-ARPSRRATWKRNN 567
            R R  E+R   ++ R+ +PTR D+AR LGYKAKQ                         +P   GV      +S + +AEE+A RK  GL VL SY++ ED  YKY+EVILVDP +  I +DP+ NWL NP ++ R  RGLTSAG++ RGL   RG KG +H+K AR  +    K+ +
Sbjct:   24 RQRLVEWRNQNTVTRIEKPTRLDRARALGYKAKQGIIVARVKVEKGGMDKQRPNS--GRRPKRMGVYGFSPAKSLQFIAEEKAARKFPGLEVLGSYYVAEDGKYKYYEVILVDPHNPVIMSDPQFNWLKNPANRGRVFRGLTSAGRRTRGLLKSRGLKGTIHYKIARKKKEREQKKRH 199          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_METMJ (50S ribosomal protein L15e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl15e PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.863e-28
Identity = 76/178 (42.70%), Postives = 101/178 (56.74%), Query Frame = 1
Query:   22 QSDVMRFL-QRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXX-KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRA 549
            +S+V   L +R++ W  R+  SIVRV  PTR D+AR LGYKAKQ                    +G    +    G+ +L   +S + +AEERA RK   +  LNSYW+ ED   K+FEVILVD  H +I++D  + WL NPVH+ R  RG TSAG K RG+R +G    K RPS R+
Sbjct:   18 RSEVKALLWERLQTW--RREGSIVRVEHPTRIDRARSLGYKAKQGIVVVRVKIRRGGRRKPRYTRG---RRSARMGMRRLTPAKSLQRMAEERASRKFPNMEALNSYWVGEDGRSKWFEVILVDGHHPSIKSDRNLAWLANPVHRGRAERGKTSAGMKGRGMRTRGRGTEKTRPSIRS 190          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15E_SULIL8.016e-2944.8550S ribosomal protein L15e OS=Sulfolobus islandicu... [more]
RL15E_SULIK8.016e-2944.8550S ribosomal protein L15e OS=Sulfolobus islandicu... [more]
RL15E_SULIA8.016e-2944.8550S ribosomal protein L15e OS=Sulfolobus islandicu... [more]
RL15E_ARCFU2.332e-2841.1450S ribosomal protein L15e OS=Archaeoglobus fulgid... [more]
RL15E_META33.046e-2840.3350S ribosomal protein L15e OS=Methanococcus aeolic... [more]
RL15E_SULTO5.196e-2841.0450S ribosomal protein L15e OS=Sulfolobus tokodaii ... [more]
RL15E_SULSO6.786e-2844.4450S ribosomal protein L15e OS=Sulfolobus solfatari... [more]
RL15E_METAC6.786e-2841.7150S ribosomal protein L15e OS=Methanosarcina aceti... [more]
RL15E_METS58.863e-2841.5750S ribosomal protein L15e OS=Metallosphaera sedul... [more]
RL15E_METMJ8.863e-2842.7050S ribosomal protein L15e OS=Methanoculleus maris... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top