DC900083

Overview
NameDC900083
Unique NameDC900083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length904
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6157 contig Csv1_Contig6157:99..990. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15_BRANA (60S ribosomal protein L15 (Fragment) OS=Brassica napus GN=RPL15 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.410e-19
Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = 1
Query:   34 MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 150
            MRF+QRVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQ
Sbjct:    3 MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQ 41          

HSP 2 Score: 36.5798 bits (83), Expect = 1.410e-19
Identity = 19/29 (65.52%), Postives = 20/29 (68.97%), Query Frame = 2
Query:  206 PRALCMVNPQTRVLLN*SFSAARGLLQRS 292
            P+ LCMVNPQTR LLN S   A  LL RS
Sbjct:   60 PKVLCMVNPQTRELLNSSSRGATVLLLRS 88          
BLAST of DC900083 vs. ExPASy Swiss-Prot
Match: RL15E_PYRAE (50S ribosomal protein L15e OS=Pyrobaculum aerophilum GN=rpl15e PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.585e-19
Identity = 62/155 (40.00%), Postives = 81/155 (52.26%), Query Frame = 1
Query:   28 DVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQXXXXXXXXXXXXXXXXXXXKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLC-NPVHKHRELRGLTSAGKK 489
            +V   L R    E+R+ P+IVRV RP R ++AR+LGYKAKQ                         +P   GV  +   +S R VAEERA RK   L VLNSYW+ +D  Y+YFEVIL+D     I+NDP  + +C   V + R +R L    KK
Sbjct:   19 EVHERLMRKILIEWRKAPAIVRVERPFRLERARKLGYKAKQGVVVVRVRLMRGPFNRRRPDS--GRRPKRMGVYGITAWKSWRQVAEERAARKHPNLEVLNSYWVADDGIYRYFEVILIDCNLPTIKNDPLYSGICGREVPRRRIIRRLRERQKK 171          
The following BLAST results are available for this feature:
BLAST of DC900083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
RL15_BRANA1.410e-1989.7460S ribosomal protein L15 (Fragment) OS=Brassica n... [more]
RL15E_PYRAE2.585e-1940.0050S ribosomal protein L15e OS=Pyrobaculum aerophil... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900083 VSS Citrus sinensis cDNA clone VS27Q90 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900083 ID=DC900083|Name=DC900083|organism=Citrus sinensis|type=EST|length=904bp
AATTCNGCACGAGGGAAGAAGCAGTCAGATGTGATGAGGTTCTTGCAGAG
GGTGAGGTGTTGGGAGTACCGCCAACATCCATCTATTGTTAGGGTCACCC
GTCCCACTCGACCTGACAAGGCTCGACGCTTGGGTTACAAGGCCAAGCAG
GGTTATGTTGTTTATCGTGTGCGGGTAAGGCGCGGTGGTCGGAACAGGCC
TGTTCCCAAGGGCATTGTGTATGGTAAACCCACAAACCAGGGTGTTACTC
AACTGAAGTTTCAGCGCAGCAAGAGGTCTGTTGCAGAGGAGCGTGCCGGT
CGTAAGTTGGGAGGTCTTAGGGTTCTCAATTCTTACTGGATCAATGAGGA
CTCCACTTATAAGTACTTTGAGGTGATCTTGGTTGATCCTGCTCATAATG
CCATCCGTAATGACCCAAGAATTAATTGGTTATGCAATCCTGTCCATAAG
CACAGGGAACTCCGTGGTCTTACTTCTGCAGGTAAGAAGTACAGAGGCCT
ACGTGGAAAAGGACACTTGCACCACAAGGCTCGGCCTTCGCGCAGGGCTA
CCTGGAAGAGAAACAATACTCTTTCCCTCCGTCGCTACCGTTGATCATTG
TTACGGTTTTGATGTTTATCATCAGTTGAGGGATTTTGTCTGGAGGACAT
AGTAGTTGCCATTTTGAGTCTTTTAGAGATTGAAATACTATGGAACATAT
CTTATTTTGAAACCGTACATTCTAAATTAAGACATTTGTGTTTCTTGAGT
CTACCTTGAATTATAAGAGCCTTAAATGTCTCATTCTGTTTAAGGTCTTG
TTGAGTATTTGTTTCGTCACTGCTGTGATTTATCACCTCTTGAACTAGCA
GATTTTAAGTTTTGGCTCAATTTTCAATTATGAGCTTGGCTTCGAGCACA
ACCA
back to top