DC900070

Overview
NameDC900070
Unique NameDC900070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5634 contig Csv1_Contig5634:1..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEB2 (Putative agmatine deiminase OS=Shewanella baltica (strain OS223) GN=aguA PE=3 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 4.269e-62
Identity = 118/204 (57.84%), Postives = 147/204 (72.06%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE+ L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+TDPQY RS  A  +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP+YE+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPDLTKEQIEDLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMCCFARPGEVILHWTDDETDPQYSRSKAAFDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNNRIVFPLL-DPATDDIAAQKLQEIFPEYEIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 4.269e-62
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA1_LISMO (Putative agmatine deiminase 1 OS=Listeria monocytogenes GN=aguA1 PE=3 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 4.269e-62
Identity = 119/203 (58.62%), Postives = 152/203 (74.88%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLL++ RNP L+K QIE  LK YL + KIIWL RG++ D+ TNGH+DN+  + +PGVV L+WTDD+TDPQYE S E   ILS+ TDA+GRKL++ K++VP P+ +T+EE+ G++      PR  G RLAASY+N+Y ANGG+I P FGD   D  A   L Q +P  EVVG+ +AREI+LGGG
Sbjct:  153 VLEGGSIHVDGEGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDE-TNGHVDNIFNYVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEESKGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFGDPN-DELAREKLQQLYPNCEVVGV-KAREILLGGG 352          

HSP 2 Score: 26.5646 bits (57), Expect = 4.269e-62
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  352 GNIHCITQQVP 362          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEPK (Agmatine deiminase OS=Pseudomonas putida (strain KT2440) GN=aguA PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 5.566e-62
Identity = 112/203 (55.17%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPHL++ QIE  L+ +L V  ++WLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   A+ +L +  DA+GR+  + K+ +PGPL+ T EE AG++Q   ++ R    RLA SYVNF I NGGIIAP F D   D EA  +L++ FP +EVV I   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTVITTEECLLNRNRNPHLSREQIEAVLRDHLAVDTVVWLPDGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLFATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPA-DAEARAILARIFPDHEVVMIP-GRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 5.566e-62
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA1_LISMF (Putative agmatine deiminase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=aguA1 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 7.258e-62
Identity = 118/203 (58.13%), Postives = 152/203 (74.88%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLL++ RNP L+K QIE  LK YL + KIIWL RG++ D+ TNGH+DN+  + +PGVV L+WTDD+TDPQYE S E   ILS+ TDA+GRKL++ K++VP P+ +T+EE+ G++      PR  G RLAASY+N+Y ANGG++ P FGD   D  A   L Q +P  EVVG+ +AREI+LGGG
Sbjct:  153 VLEGGSIHVDGEGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDE-TNGHVDNIFNYVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEESKGVDAVEGTLPREEGDRLAASYINYYTANGGVVFPLFGDPN-DELAREKLRQLYPNCEVVGV-KAREILLGGG 352          

HSP 2 Score: 26.5646 bits (57), Expect = 7.258e-62
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  352 GNIHCITQQVP 362          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHESA (Putative agmatine deiminase OS=Shewanella sp. (strain ANA-3) GN=aguA PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.234e-61
Identity = 118/204 (57.84%), Postives = 147/204 (72.06%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+TT ECLLN NRNP L K QIE  L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP++++VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTTAECLLNANRNPDLTKEQIEALLRDYLNVKQFIWLEEGVYMDE-TDGHIDNMCCFARPGEVILHWTDDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNDRIVFPLL-DPATDDIAAQKLQEIFPEHKIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 1.234e-61
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEB8 (Putative agmatine deiminase OS=Shewanella baltica (strain OS185) GN=aguA PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.234e-61
Identity = 118/204 (57.84%), Postives = 147/204 (72.06%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE+ L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+ DPQY RS  AL +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP+YE+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPDLTKEQIEDLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMCCFARPGEVILHWTDDEADPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESLGVT-EGTGVPRTAGERLAGSYVNFLITNHRIVFPLL-DPTTDDIAAQKLQEIFPEYEIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 1.234e-61
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHESM (Putative agmatine deiminase OS=Shewanella sp. (strain MR-4) GN=aguA PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.098e-61
Identity = 118/204 (57.84%), Postives = 146/204 (71.57%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+TT ECLLN NRNP L K QIE  L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L   FP++++VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTTAECLLNANRNPDLTKEQIEALLRDYLNVKQFIWLEEGVYMDE-TDGHIDNMCCFARPGEVILHWTDDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNDRIVFPLL-DPATDDIAAQKLQDIFPEHKIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 2.098e-61
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHESR (Putative agmatine deiminase OS=Shewanella sp. (strain MR-7) GN=aguA PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.735e-61
Identity = 118/204 (57.84%), Postives = 146/204 (71.57%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+TT ECLLN NRNP L K QIE  L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY TEEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L   FP++++VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTTAECLLNANRNPDLTKEQIEALLRDYLNVKQFIWLEEGVYMDE-TDGHIDNMCCFARPGEVVLHWTDDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNDRIVFPLL-DPATDDIAAQKLQDIFPEHKIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 2.735e-61
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEFN (Putative agmatine deiminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aguA PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.735e-61
Identity = 117/204 (57.35%), Postives = 145/204 (71.08%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+TT ECLLN NRNP L + QIE  L  YL V + IWLP G++ D+ T+GHIDN+CCF++PG V+L WTDD++DPQY RS  AL IL +  DA+GRKL +  +  PGPLY TEEEA G+  +G   PR AG RLA SY NF I N  I+ P   D   D  A + L + FP+YE+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTTAECLLNSNRNPDLTREQIEALLAEYLNVKQFIWLPDGVYMDE-TDGHIDNLCCFARPGEVVLHWTDDQSDPQYPRSKAALDILQNTVDAQGRKLTVHLIPQPGPLYCTEEEAQGV-AEGTGVPRTAGERLAGSYANFLITNNRIVFPLL-DPVTDDIAAQKLQEIFPEYEIVGVP-AREILLGGG 357          

HSP 2 Score: 26.5646 bits (57), Expect = 2.735e-61
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ P+
Sbjct:  357 GNIHCITQQIPS 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEON (Putative agmatine deiminase OS=Shewanella oneidensis GN=aguA PE=3 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 4.650e-61
Identity = 116/204 (56.86%), Postives = 147/204 (72.06%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE  L+ YL V + IWL  G++ D+ T+GHIDNMCCF++PG V+L WTDD++DPQY RS  AL +L +  DA+GRKL+I  L  PGPLY +EEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP++E+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPELTKEQIEGLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMCCFARPGEVILHWTDDESDPQYPRSKAALEVLQNTVDAQGRKLKIHLLPQPGPLYCSEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNHRIVFPLL-DPATDDIAAQKLQEIFPEHEIVGVP-AREILLGGG 357          

HSP 2 Score: 27.7202 bits (60), Expect = 4.650e-61
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  357 GNIHCITQQIPA 368          
The following BLAST results are available for this feature:
BLAST of DC900070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
AGUA_SHEB24.269e-6257.84Putative agmatine deiminase OS=Shewanella baltica ... [more]
AGUA1_LISMO4.269e-6258.62Putative agmatine deiminase 1 OS=Listeria monocyto... [more]
AGUA_PSEPK5.566e-6255.17Agmatine deiminase OS=Pseudomonas putida (strain K... [more]
AGUA1_LISMF7.258e-6258.13Putative agmatine deiminase 1 OS=Listeria monocyto... [more]
AGUA_SHESA1.234e-6157.84Putative agmatine deiminase OS=Shewanella sp. (str... [more]
AGUA_SHEB81.234e-6157.84Putative agmatine deiminase OS=Shewanella baltica ... [more]
AGUA_SHESM2.098e-6157.84Putative agmatine deiminase OS=Shewanella sp. (str... [more]
AGUA_SHESR2.735e-6157.84Putative agmatine deiminase OS=Shewanella sp. (str... [more]
AGUA_SHEFN2.735e-6157.35Putative agmatine deiminase OS=Shewanella frigidim... [more]
AGUA_SHEON4.650e-6156.86Putative agmatine deiminase OS=Shewanella oneidens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900070 VSS Citrus sinensis cDNA clone VS27Q75 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900070 ID=DC900070|Name=DC900070|organism=Citrus sinensis|type=EST|length=877bp
ATTTCCACATTCTATGGTTCTCGAAGGGGGAAGCATCCATGTGGATGGAG
AAGGTACATGCTTAACTACAGAGGAGTGCCTCTTGAACAAAAACAGGAAC
CCACATTTGAACAAAGGACAAATAGAGAACGAACTTAAGGCATATCTTGG
AGTCATGAAGATTATATGGTTGCCTCGTGGATTATTTGGTGATGATGATA
CTAATGGCCATATTGACAATATGTGCTGTTTTTCAAAGCCTGGTGTGGTG
TTACTGTCTTGGACTGATGATAAAACAGATCCTCAGTACGAACGATCTGT
GGAGGCGTTGACTATTCTCTCTGATGCTACTGATGCCAGAGGTCGGAAAT
TACAAATAATTAAACTTCATGTACCAGGGCCACTTTATATGACAGAAGAA
GAAGCTGCTGGACTTAATCAGGATGGTGAGGCTAAACCAAGACTTGCGGG
TACAAGACTTGCTGCTTCATATGTGAATTTCTACATTGCAAATGGAGGAA
TCATCGCACCACAGTTTGGGGACAAAAAGTGGGACGGTGAAGCTGTTCGT
GTCCTGTCTCAAGCCTTTCCTAAGTATGAAGTGGTAGGAATTGAAAGAGC
AAGGGAAATTGTTTTGGGAGGTGGGAAATATACATTGCATTACTCAACAA
CAACCAGCCATTCCAACAAATGCTGCGAAGCTAGACTGATTAGATACTGA
AATTATAACTGTNAANTCAGAGGCAGCAGCGTTGATCTCCAGATTGAGCA
TGTGTGTTTTTAAGAGGACATAATTTAAGCATTTGACAGTTAGTAGCTCT
GTGGGAATCCTGATGATTGATTGGCAAACACTGTCTTAAATAACATATGA
TAAAGCTTAAGCAAAATCAAAGGAAAA
back to top