DC900070

Overview
NameDC900070
Unique NameDC900070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5634 contig Csv1_Contig5634:1..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHESW (Putative agmatine deiminase OS=Shewanella sp. (strain W3-18-1) GN=aguA PE=3 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.344e-60
Identity = 116/204 (56.86%), Postives = 147/204 (72.06%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE+ L+ YL V + IWL  G++ D+ T+GHIDNM CF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY +EEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP++E+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPELTKEQIEDLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMSCFARPGEVILHWTDDETDPQYPRSKAALEVLQNTVDAKGRKLKIHLLPQPGPLYCSEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNHRIVFPLL-DPATDDIAAQKLQEIFPEHEIVGVP-AREILLGGG 357          

HSP 2 Score: 27.7202 bits (60), Expect = 1.344e-60
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  357 GNIHCITQQIPA 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SHEPC (Putative agmatine deiminase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aguA PE=3 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.344e-60
Identity = 116/204 (56.86%), Postives = 147/204 (72.06%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGTC+T+ ECLLN NRNP L K QIE+ L+ YL V + IWL  G++ D+ T+GHIDNM CF++PG V+L WTDD+TDPQY RS  AL +L +  DA+GRKL+I  L  PGPLY +EEE+ G+  +G   PR AG RLA SYVNF I N  I+ P   D   D  A + L + FP++E+VG+  AREI+LGGG
Sbjct:  158 LILEGGSIHVDGEGTCMTSAECLLNANRNPELTKEQIEDLLRDYLNVKQFIWLQDGVYMDE-TDGHIDNMSCFARPGEVILHWTDDETDPQYPRSKAALEVLQNTVDAKGRKLKIHLLPQPGPLYCSEEESKGVT-EGTGVPRTAGERLAGSYVNFLITNHRIVFPLL-DPATDDIAAQKLQEIFPEHEIVGVP-AREILLGGG 357          

HSP 2 Score: 27.7202 bits (60), Expect = 1.344e-60
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  357 GNIHCITQQIPA 368          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_MYCCT (Putative agmatine deiminase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=aguA PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.752e-60
Identity = 114/203 (56.16%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIH DG+GT  TTEECLLN+NRNP L+K QIE  LK Y GV K+IWLP G++ +D+TNGH+DN+     PG V+L+WTDD TDPQYERS  A  IL++  DA+GRK+++ KLH PGPL++T+EEA G++   +   R    R+ ASY NFYIAN  II P FGD K+D  AV+ L   +P +++  +  AREI+LGGG
Sbjct:  153 VLEGGSIHTDGDGTLYTTEECLLNENRNPDLSKEQIEENLKEYCGVEKVIWLPLGVY-NDETNGHVDNLLHVVSPGHVVLTWTDDTTDPQYERSKLAYDILTNTLDAKGRKIKVTKLHQPGPLFITKEEAEGIDV-CDTMSREPEQRMPASYANFYIANNAIILPIFGD-KYDDLAVKTLQSVYPNHKIETV-MAREILLGGG 351          

HSP 2 Score: 29.261 bits (64), Expect = 1.752e-60
Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQQP
Sbjct:  351 GNIHCITQQQP 361          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_LACSS (Putative agmatine deiminase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=aguA PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.979e-60
Identity = 115/204 (56.37%), Postives = 150/204 (73.53%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            +VLEGGS HVDGEGT L TEECLL+  RNP L+K QIE+ LK YL V KIIWL +G++ D+ TNGH+DN+  F KPG V+L+WTDD++DPQY  S E   +L + TDA+GRKLQ+ KL++P P+ +TE E+ G++      PRLAG RLAASYVN+Y ANGGI+ P F D   D +A  +L + +P  ++VG+  AREI+LGGG
Sbjct:  152 LVLEGGSTHVDGEGTLLVTEECLLSDGRNPQLSKEQIESILKEYLNVEKIIWLKKGIYLDE-TNGHVDNIANFVKPGQVVLAWTDDQSDPQYAISKENYDMLINETDAKGRKLQVEKLYLPKPILITEAESQGVDTVDGTLPRLAGDRLAASYVNYYTANGGIVFPLFND-PMDEKAQEILQKLYPDRKIVGVP-AREILLGGG 352          

HSP 2 Score: 27.7202 bits (60), Expect = 2.979e-60
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  352 GNIHCITQQIPA 363          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_MYCMS (Putative agmatine deiminase OS=Mycoplasma mycoides subsp. mycoides SC GN=aguA PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 5.064e-60
Identity = 113/203 (55.67%), Postives = 146/203 (71.92%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIH DG+GT  TTEECLLN+NRNP L K QIE  LK Y GV K+IWLP G++ +D+TNGH+DN+     PG V+L+WTDD TDPQYERS  A  IL++  DA+GRK+++ KLH PGPL++T+EEA G++   +   R    R+ ASY N+YIAN  II P FGD K+D  AV+ L   +P +++  +  AREI+LGGG
Sbjct:  153 VLEGGSIHTDGDGTLYTTEECLLNENRNPDLTKEQIEENLKEYCGVEKVIWLPLGVY-NDETNGHVDNLLNVVSPGHVVLTWTDDTTDPQYERSKLAYDILTNTLDAKGRKIKVTKLHQPGPLFITKEEAEGIDV-CDTMSREPEQRMPASYANYYIANNAIILPIFGD-KYDDLAVKTLQSVYPNHKIETV-MAREILLGGG 351          

HSP 2 Score: 29.261 bits (64), Expect = 5.064e-60
Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQQP
Sbjct:  351 GNIHCITQQQP 361          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA2_LISMF (Putative agmatine deiminase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=aguA2 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 8.513e-57
Identity = 113/203 (55.67%), Postives = 143/203 (70.44%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            +LEG SIHVDGEGT +TTEECLL++ RNP+L K +IE  LK Y  V K+IWL  G + D+ TNGH+DN+  F  PG V+LSWTD+K+DPQYE S E   IL++ TDA+GR   I KLH P P+ +T+ E+ G+       PR AG RLAASYVN+Y ANG II P F D K D +A  +L Q +P  ++VGI +AREI+LGGG
Sbjct:  153 ILEGCSIHVDGEGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHVQKVIWLKHGFYLDE-TNGHVDNIFNFVAPGEVVLSWTDNKSDPQYEISRECYDILANQTDAKGRTFMIHKLHCPDPVLITQTESEGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPK-DKDAQELLEQLYPDRKIVGI-KAREILLGGG 352          

HSP 2 Score: 24.6386 bits (52), Expect = 8.513e-57
Identity = 9/11 (81.82%), Postives = 9/11 (81.82%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQ  P
Sbjct:  352 GNIHCITQHLP 362          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_MARMS (Putative agmatine deiminase OS=Marinomonas sp. (strain MWYL1) GN=aguA PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.886e-56
Identity = 111/204 (54.41%), Postives = 148/204 (72.55%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIHVDGEGT  TTEECLL+ +RNPHL+K  IE+ LK YL V KIIWL  GL+ +D+TNGH+DN+    +PGVV L+  +D  DPQY  S  A+ +LS A DA+GR L+IIKL +PGPL+++E+EA  L +  ++  R  G RLAASY NF I N  I+ P FG+K  D +A  +L +AFP+++V+G+  AR I+LGGG
Sbjct:  152 LILEGGSIHVDGEGTLYTTEECLLHPSRNPHLSKEDIEDLLKVYLNVEKIIWLKDGLY-NDETNGHVDNIMHVIRPGVVALTDCEDSNDPQYAISKAAIKVLSQAIDAKGRTLEIIKLPMPGPLFVSEDEAKNLLK-SDSMNRQVGERLAASYANFLITNNSIVFPTFGEKT-DEQAKEILQKAFPEHKVIGV-YARNILLGGG 351          

HSP 2 Score: 26.5646 bits (57), Expect = 1.886e-56
Identity = 10/11 (90.91%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQQ P
Sbjct:  351 GNIHCITQQVP 361          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_VIBPA (Putative agmatine deiminase OS=Vibrio parahaemolyticus GN=aguA PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.207e-56
Identity = 105/203 (51.72%), Postives = 142/203 (69.95%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGG+IH DGEGT  TTEECLL+  RNP L+K QIE +LK YLG+ KIIWLP GLF +D+T+GH+DN+     PG V+LSWTDD +DPQY  S +A  +L    DA+GR+++I++L +PGPL+ +E EA G++       R AG RL+ASY NF I NG +  P   D+  D  A+ +L  A P+Y+++ I  +RE++LGGG
Sbjct:  151 VLEGGAIHTDGEGTLYTTEECLLSPGRNPQLSKAQIEEQLKVYLGIEKIIWLPNGLF-NDETDGHVDNLMHVIAPGKVVLSWTDDPSDPQYALSRQAEQVLKSQHDAKGREIEIVRLPLPGPLHYSEREANGIDA-SSGMSRQAGERLSASYANFLIVNGHVFLPML-DEDTDAIAIDILQNAMPEYQIIAIP-SREVLLGGG 349          

HSP 2 Score: 27.7202 bits (60), Expect = 3.207e-56
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  349 GNIHCITQQIPA 360          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_SELRU (Putative agmatine deiminase OS=Selenomonas ruminantium GN=aguA PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.104e-56
Identity = 113/204 (55.39%), Postives = 142/204 (69.61%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVP-GPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT + TE CLL++ RNP L+K QIE  L  YLG  K+IWLPRG+  +D+TN H+DN+  F +PG VLL+WTDDK DPQYE S   L +L  ATDARGRK  I KL +P  P+ +T EEA     +     R  G RLAASYVNFY+ NG +I PQFGD + D EA R+L + FP+ +VV +  A+ +++GGG
Sbjct:  157 VLEGGSIHVDGEGTVVVTEACLLSQGRNPDLSKEQIEAMLLKYLGAEKVIWLPRGIH-NDETNEHVDNVFAFVRPGEVLLAWTDDKDDPQYELSQADLEVLESATDARGRKFVIHKLPIPQEPVCITAEEADSFTFEEGEDRREPGERLAASYVNFYLCNGKVILPQFGD-EMDIEAQRILGKCFPERKVVPLP-AKAVIVGGG 357          

HSP 2 Score: 26.9498 bits (58), Expect = 7.104e-56
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  624 GNIHCITQQQPAI 662
            GN HC+TQQ PAI
Sbjct:  357 GNFHCLTQQIPAI 369          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA2_LISMO (Putative agmatine deiminase 2 OS=Listeria monocytogenes GN=aguA2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.574e-55
Identity = 111/203 (54.68%), Postives = 142/203 (69.95%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            +LEG SIHVDGEGT +TTEECLL++ RNP+L K +IE  LK Y    K+IWL  G + D+ TNGH+DN+  F  PG V+LSWTD+K+DPQYE S E   IL++ TDA+GR   I KLH P P+ +T+ E+ G+       PR AG RLAASYVN+Y ANG II P F D K D +A  +L + +P  ++VGI +AREI+LGGG
Sbjct:  153 ILEGCSIHVDGEGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHAQKVIWLKHGFYLDE-TNGHVDNIFNFVAPGEVVLSWTDNKSDPQYEISRECYDILANKTDAKGRTFIIHKLHCPDPVLITQTESEGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPK-DKDAQELLEKLYPDRKIVGI-KAREILLGGG 352          

HSP 2 Score: 24.6386 bits (52), Expect = 1.574e-55
Identity = 9/11 (81.82%), Postives = 9/11 (81.82%), Query Frame = 3
Query:  624 GNIHCITQQQP 656
            GNIHCITQ  P
Sbjct:  352 GNIHCITQHLP 362          
The following BLAST results are available for this feature:
BLAST of DC900070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
AGUA_SHESW1.344e-6056.86Putative agmatine deiminase OS=Shewanella sp. (str... [more]
AGUA_SHEPC1.344e-6056.86Putative agmatine deiminase OS=Shewanella putrefac... [more]
AGUA_MYCCT1.752e-6056.16Putative agmatine deiminase OS=Mycoplasma capricol... [more]
AGUA_LACSS2.979e-6056.37Putative agmatine deiminase OS=Lactobacillus sakei... [more]
AGUA_MYCMS5.064e-6055.67Putative agmatine deiminase OS=Mycoplasma mycoides... [more]
AGUA2_LISMF8.513e-5755.67Putative agmatine deiminase 2 OS=Listeria monocyto... [more]
AGUA_MARMS1.886e-5654.41Putative agmatine deiminase OS=Marinomonas sp. (st... [more]
AGUA_VIBPA3.207e-5651.72Putative agmatine deiminase OS=Vibrio parahaemolyt... [more]
AGUA_SELRU7.104e-5655.39Putative agmatine deiminase OS=Selenomonas ruminan... [more]
AGUA2_LISMO1.574e-5554.68Putative agmatine deiminase 2 OS=Listeria monocyto... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900070 VSS Citrus sinensis cDNA clone VS27Q75 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900070 ID=DC900070|Name=DC900070|organism=Citrus sinensis|type=EST|length=877bp
ATTTCCACATTCTATGGTTCTCGAAGGGGGAAGCATCCATGTGGATGGAG
AAGGTACATGCTTAACTACAGAGGAGTGCCTCTTGAACAAAAACAGGAAC
CCACATTTGAACAAAGGACAAATAGAGAACGAACTTAAGGCATATCTTGG
AGTCATGAAGATTATATGGTTGCCTCGTGGATTATTTGGTGATGATGATA
CTAATGGCCATATTGACAATATGTGCTGTTTTTCAAAGCCTGGTGTGGTG
TTACTGTCTTGGACTGATGATAAAACAGATCCTCAGTACGAACGATCTGT
GGAGGCGTTGACTATTCTCTCTGATGCTACTGATGCCAGAGGTCGGAAAT
TACAAATAATTAAACTTCATGTACCAGGGCCACTTTATATGACAGAAGAA
GAAGCTGCTGGACTTAATCAGGATGGTGAGGCTAAACCAAGACTTGCGGG
TACAAGACTTGCTGCTTCATATGTGAATTTCTACATTGCAAATGGAGGAA
TCATCGCACCACAGTTTGGGGACAAAAAGTGGGACGGTGAAGCTGTTCGT
GTCCTGTCTCAAGCCTTTCCTAAGTATGAAGTGGTAGGAATTGAAAGAGC
AAGGGAAATTGTTTTGGGAGGTGGGAAATATACATTGCATTACTCAACAA
CAACCAGCCATTCCAACAAATGCTGCGAAGCTAGACTGATTAGATACTGA
AATTATAACTGTNAANTCAGAGGCAGCAGCGTTGATCTCCAGATTGAGCA
TGTGTGTTTTTAAGAGGACATAATTTAAGCATTTGACAGTTAGTAGCTCT
GTGGGAATCCTGATGATTGATTGGCAAACACTGTCTTAAATAACATATGA
TAAAGCTTAAGCAAAATCAAAGGAAAA
back to top