DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BRAJA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bradyrhizobium japonicum GN=metE PE=3 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 1.898e-43
Identity = 90/145 (62.07%), Postives = 107/145 (73.79%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+S+   YLDWA   FRI + GV D TQIHTHMCYS FNDII +I  MDADVI+IE SRS  +LL  FR   +Y   IGPGVYDIHSPR+P T+E+ + I      L+ + LWVNPDCGLKTRK+ EV+PAL+NMVAAA+ LR
Sbjct:  630 PLRRSDWKAYLDWAGDCFRICSSGVTDQTQIHTHMCYSEFNDIIGAIAAMDADVISIETSRSKMELLDAFRR-YEYPNQIGPGVYDIHSPRVPETDEMKELIVLARTRLQDSQLWVNPDCGLKTRKWEEVRPALANMVAAARELR 773          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_SALRD (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Salinibacter ruber (strain DSM 13855) GN=metE PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.479e-43
Identity = 86/145 (59.31%), Postives = 107/145 (73.79%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+ +   YLDWAV  FR+ + GV+D TQIHTHMCYS FNDII +I DMDADVI++E SRS  +LL  F +   Y   IGPGVYDIHSPR+PS EE+ + I   L  LE + +WVNPDCGLKTR++ EV+P+L NMV AA+ +R
Sbjct:  621 PLREHQWDDYLDWAVECFRLASSGVRDETQIHTHMCYSEFNDIIEAIADMDADVISVEASRSKMELLDSF-DAFDYPNEIGPGVYDIHSPRVPSVEEMEELIRTALDALEPSQMWVNPDCGLKTRRWVEVQPSLENMVQAAENVR 764          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_NITWN (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metE PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.238e-43
Identity = 87/145 (60.00%), Postives = 103/145 (71.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+SE   YLDWAV  FR+   GV D TQIHTHMCYS FNDII +I  MDADVI+IE SRS  +LL  F+   KY   IGPGVYDIHSPR+P+ +E+   +      L    +W+NPDCGLKTRK+ EV+PAL NMV AAKL+R
Sbjct:  628 PLRRSEWKTYLDWAVECFRLCASGVADATQIHTHMCYSEFNDIIDAIASMDADVISIETSRSKMELLDAFKT-YKYPNEIGPGVYDIHSPRVPAVDEMTGLLKLARERLSDRQIWINPDCGLKTRKWEEVRPALVNMVEAAKLMR 771          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_THIDA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=metE PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.213e-43
Identity = 89/145 (61.38%), Postives = 102/145 (70.34%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+S+   YL WAV SFRI   GV D TQIHTHMCYS FNDII +I  MDADVITIE SRSD +LL  F +   Y   IGPGVYDIHSP IP+ + I + I K    +    LW+NPDCGLKTR++ EV PAL NMVAAA+ LR
Sbjct:  619 PLRRSQWKTYLGWAVESFRIAANGVADETQIHTHMCYSEFNDIIEAIAAMDADVITIETSRSDMELLDAF-DHFSYPNEIGPGVYDIHSPNIPTPQHIVNLIKKAAERIPAERLWINPDCGLKTRQWNEVIPALGNMVAAARTLR 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_DICDI (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Dictyostelium discoideum GN=metE PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.213e-43
Identity = 86/145 (59.31%), Postives = 106/145 (73.10%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR S+   YL WA+ SF +++ GV+D+TQIH+HMCYS+FNDI  SI  MD DV+TIENS+SD KLL  F E   Y   IGPG+YDIHSPRIPS E++ DR+ +ML  L TN+LW+NPDCGLKTR+    + AL NMV  AK  R
Sbjct:  675 PLRLSDWNQYLKWAIDSFLLSSTGVKDSTQIHSHMCYSDFNDIFESIQRMDTDVLTIENSKSDLKLLKAF-EKYGYTNEIGPGLYDIHSPRIPSVEDMKDRVEQMLKYLSTNLLWINPDCGLKTREPETTRLALINMVKVAKQFR 818          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_DESRM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=metE PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.213e-43
Identity = 86/148 (58.11%), Postives = 109/148 (73.65%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLRK + A+Y +WAV SF++        TQIHTHMCYS+FNDIIH+I  MDADVITIE SRS  KLL+VF     Y   IGPG+YDIHSPR+PS EE+ ++I  ++ VL  + LW+NPDCGLKTRK+ E++ +LSNMV AA+ +R  L
Sbjct:  612 PLRKEKVAYYENWAVKSFKLAVSSAAIETQIHTHMCYSDFNDIIHTIEKMDADVITIETSRSGNKLLTVFATR-GYKNEIGPGIYDIHSPRVPSVEELEEKIRNLMLVLPPSKLWINPDCGLKTRKWDEIRWSLSNMVKAAQHIRLGL 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSESM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas syringae pv. tomato GN=metE PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.420e-43
Identity = 89/145 (61.38%), Postives = 102/145 (70.34%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLRK++   YLDWAV +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+P T E+   I K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR
Sbjct:  622 PLRKAQWQQYLDWAVAAFRLCASGVRDETQIHTHMCYSEFNDVIKSIAAMDADVITIETSRSDMELLDAF-EAFDYPNDIGPGVYDIHSPRVPETAEMVSLIAKAARRIPAERLWVNPDCGLKTRGWPETEAALINMVAAARQLR 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEMY (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=metE PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.230e-42
Identity = 88/149 (59.06%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLR++    YLDWA  +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+P + E+A  + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR +LA
Sbjct:  620 PLRQAAWQGYLDWATEAFRLAASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-ERFAYPNEIGPGVYDIHSPRVPDSAEMAGLLRKAARRIPLERLWVNPDCGLKTRAWPETEAALVNMVAAARQLRAELA 767          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEAE (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa GN=metE PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.230e-42
Identity = 89/149 (59.73%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLR++    YL+WA  +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+PS EEI   + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR  LA
Sbjct:  617 PLRRNAWPHYLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-EQFDYPNEIGPGVYDIHSPRVPSREEIVALLRKAARRIPAERLWVNPDCGLKTRAWPETEAALVNMVAAARELRGDLA 764          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEAB (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metE PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.230e-42
Identity = 89/149 (59.73%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLR++    YL+WA  +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+PS EEI   + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR  LA
Sbjct:  617 PLRRNAWPHYLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-EQFDYPNEIGPGVYDIHSPRVPSREEIVALLRKAARRIPAERLWVNPDCGLKTRAWPETEAALVNMVAAARELRGDLA 764          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_BRAJA1.898e-4362.075-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_SALRD2.479e-4359.315-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_NITWN3.238e-4360.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_THIDA7.213e-4361.385-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_DICDI7.213e-4359.315-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_DESRM7.213e-4358.115-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSESM9.420e-4361.385-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEMY1.230e-4259.065-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEAE1.230e-4259.735-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEAB1.230e-4259.735-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top