DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEA8 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=metE PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.230e-42
Identity = 89/149 (59.73%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLR++    YL+WA  +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+PS EEI   + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR  LA
Sbjct:  617 PLRRNAWPHYLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-EQFDYPNEIGPGVYDIHSPRVPSREEIVALLRKAARRIPAERLWVNPDCGLKTRAWPETEAALVNMVAAARELRGDLA 764          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RUTMC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=metE PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.099e-42
Identity = 86/145 (59.31%), Postives = 103/145 (71.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLRKS+   YLDWA+ ++R++  GV D TQIHTHMCYS FNDII +I  MDADVITIE SRSD +LL +F E   Y   IGPGVYDIHSP IPS + I + + K    +    LWVNPDCGLKTR + EV  AL+NMV A++ LR
Sbjct:  613 PLRKSQWQTYLDWAIRAYRVSANGVSDETQIHTHMCYSEFNDIIEAIAQMDADVITIETSRSDMELLDIFDE-FDYPNEIGPGVYDIHSPNIPSVDSIVELMQKAAKYIPIKRLWVNPDCGLKTRHWDEVNLALTNMVLASQQLR 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEU5 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=metE PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.099e-42
Identity = 86/145 (59.31%), Postives = 100/145 (68.97%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+ +   YLDWAV +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRS  +LL  FR    Y   IGPGVYDIHSPR+P T E+   + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR
Sbjct:  620 PLRREQWRHYLDWAVEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSQMELLEAFR-AFDYPNDIGPGVYDIHSPRVPDTAEMVQLLEKAAECIPAERLWVNPDCGLKTRGWPETEAALVNMVAAARQLR 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_COXB1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=metE PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.099e-42
Identity = 87/152 (57.24%), Postives = 105/152 (69.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRK+    YL+WAV  FR+ +CGV+D TQIHTHMCYS FNDII +I  +DADVITIE+SRS+ ++L  F E   Y   IGPG+YDIHSPRIP   EI +   + L  +    LW+NPDCGLKTR + E K ALS MV AAK LR   +S K
Sbjct:  612 PLRKAAWQDYLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDADVITIESSRSETEILKSF-EKFAYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPIERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEK 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_COXBU (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii GN=metE PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.741e-42
Identity = 87/152 (57.24%), Postives = 105/152 (69.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRK+    YL+WAV  FR+ +CGV+D TQIHTHMCYS FNDII +I  +DADVITIE+SRS+ ++L  F E   Y   IGPG+YDIHSPRIP   EI +   + L  +    LW+NPDCGLKTR + E K ALS MV AAK LR   +S K
Sbjct:  612 PLRKAAWQDYLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDADVITIESSRSEMEILKSF-EKFAYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPIERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEK 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_COXBR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metE PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.741e-42
Identity = 87/152 (57.24%), Postives = 105/152 (69.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRK+    YL+WAV  FR+ +CGV+D TQIHTHMCYS FNDII +I  +DADVITIE+SRS+ ++L  F E   Y   IGPG+YDIHSPRIP   EI +   + L  +    LW+NPDCGLKTR + E K ALS MV AAK LR   +S K
Sbjct:  612 PLRKAAWQDYLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDADVITIESSRSEMEILKSF-EKFAYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPIERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEK 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_COXBN (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metE PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.741e-42
Identity = 87/152 (57.24%), Postives = 105/152 (69.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRK+    YL+WAV  FR+ +CGV+D TQIHTHMCYS FNDII +I  +DADVITIE+SRS+ ++L  F E   Y   IGPG+YDIHSPRIP   EI +   + L  +    LW+NPDCGLKTR + E K ALS MV AAK LR   +S K
Sbjct:  612 PLRKAAWQDYLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDADVITIESSRSEMEILKSF-EKFAYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPIERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEK 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_COXB2 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=metE PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.741e-42
Identity = 87/152 (57.24%), Postives = 105/152 (69.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRK+    YL+WAV  FR+ +CGV+D TQIHTHMCYS FNDII +I  +DADVITIE+SRS+ ++L  F E   Y   IGPG+YDIHSPRIP   EI +   + L  +    LW+NPDCGLKTR + E K ALS MV AAK LR   +S K
Sbjct:  612 PLRKAAWQDYLEWAVKCFRLASCGVKDETQIHTHMCYSEFNDIIEAIAALDADVITIESSRSEMEILKSF-EKFAYPNDIGPGIYDIHSPRIPRVAEIEELAVRALQYIPIERLWINPDCGLKTRNWEETKEALSRMVDAAKHLRKAFSSEK 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEA7 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=metE PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.580e-42
Identity = 84/145 (57.93%), Postives = 104/145 (71.72%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+++   YL+WA  +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+P+ E++   ++K    +    LWVNPDCGLKTR + E + AL+NMVAAA+ LR
Sbjct:  615 PLRRADWPHYLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-EAFAYPNEIGPGVYDIHSPRVPAVEDMVKLLSKAAERIPAARLWVNPDCGLKTRAWAETEAALANMVAAARQLR 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_ALHEH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=metE PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.580e-42
Identity = 87/152 (57.24%), Postives = 106/152 (69.74%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PL++ +   YLDWAV  FR+T    QD TQIHTHMCYS FNDI+ +I  +DADVITIE SRSD +LL VF EG +Y   IGPGVYDIHSP  PS + +   + K    +    LWVNPDCGLKTR + EV+PAL NMVAAA++LR +   A+
Sbjct:  614 PLQQRQWPGYLDWAVDCFRLTASVAQDATQIHTHMCYSEFNDIMGAIATLDADVITIETSRSDMELLEVF-EGFEYPNEIGPGVYDIHSPNTPSVDWMVRLMEKAARRIPVERLWVNPDCGLKTRAWAEVEPALQNMVAAAEILRERYGQAQ 764          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_PSEA81.230e-4259.735-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RUTMC2.099e-4259.315-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEU52.099e-4259.315-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_COXB12.099e-4257.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_COXBU2.741e-4257.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_COXBR2.741e-4257.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_COXBN2.741e-4257.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_COXB22.741e-4257.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEA73.580e-4257.935-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ALHEH3.580e-4257.245-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top