DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBVU (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio vulnificus GN=metE PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.675e-42
Identity = 85/149 (57.05%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL+K +H  YLDWAV +FRI+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IPS E I D + K    +    LWVNPDCGLKTR + E + AL+N+V+AAK LR + A
Sbjct:  613 PLKKRDHQNYLDWAVEAFRISAASARPETQIHTHMCYSEFNEIIESVAALDADVITIETSRSNMELLKAFEE-FNYPNEIGPGVYDIHSPNIPSEEWIVDLVKKAAQKIPVERLWVNPDCGLKTRNWPETEAALANLVSAAKRLRKEFA 760          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEPW (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas putida (strain W619) GN=metE PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.106e-42
Identity = 87/145 (60.00%), Postives = 101/145 (69.66%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+S    YL+WA  +FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+PS EE+   + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR
Sbjct:  620 PLRRSAWPAYLEWATEAFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-EKFDYPNEIGPGVYDIHSPRVPSREEMVKLLRKAALRIPAERLWVNPDCGLKTRAWPETEAALVNMVAAARELR 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEF5 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metE PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.975e-42
Identity = 85/149 (57.05%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLR+++   YLDWA   FR+   GV+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F+    Y   IGPGVYDIHSPR+P   E+A+ + K    +    LWVNPDCGLKTR + E + AL +MV AA+ LR +LA
Sbjct:  615 PLRRAQWQHYLDWATEVFRLCASGVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLDAFK-AFAYPNEIGPGVYDIHSPRVPDASEMANLLRKAAQRIPAERLWVNPDCGLKTRGWPETEAALVHMVTAARQLRKELA 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_MESSB (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesorhizobium sp. (strain BNC1) GN=metE PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.975e-42
Identity = 84/145 (57.93%), Postives = 106/145 (73.10%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR++E   YLDWAV  FR+ + GV+  TQIHTHMCY+ FNDII +I  MDADVI+IE SRS  +LL  FR   +Y   IGPGV+DIHSPR+P  +E+AD + K    L+   +WVNPDCGLKTRK+ EV+ AL+NMV AA+ +R
Sbjct:  624 PLREAERPAYLDWAVECFRLASSGVKPETQIHTHMCYAEFNDIIDAIAAMDADVISIETSRSKMELLRAFR-AFRYPNDIGPGVFDIHSPRVPPADEMADLLRKAEDGLDPRQIWVNPDCGLKTRKWEEVRFALANMVEAARQMR 767          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBVY (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=metE PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.042e-41
Identity = 84/149 (56.38%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL+K +H  YLDWA+ +FRI+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IPS E I D + K    +    LWVNPDCGLKTR + E + AL+N+V+AAK LR + A
Sbjct:  613 PLKKRDHQNYLDWALEAFRISAASARPETQIHTHMCYSEFNEIIESVAALDADVITIETSRSNMELLKAFEE-FNYPNEIGPGVYDIHSPNIPSEEWIVDLVKKAAQKIPVERLWVNPDCGLKTRNWPETEAALANLVSAAKRLRKEFA 760          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_XYLFA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa GN=metE PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.360e-41
Identity = 86/147 (58.50%), Postives = 104/147 (70.75%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PLR+ E A YL+WAV SFRI +  V+DTTQIHTHMCYS FNDII ++  +DADVI+IE SRS  +LL  F +  +Y   IGPGVYDIHSPR+P  EE+   + K  AVL    LWVNPDCGLKTR + E + AL  MV AA+ LR +
Sbjct:  613 PLRRGEWADYLNWAVESFRIASSNVRDTTQIHTHMCYSEFNDIIEAVAALDADVISIETSRSRMELLDAFVK-FRYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPPEQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BLOFL (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Blochmannia floridanus GN=metE PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.360e-41
Identity = 79/145 (54.48%), Postives = 106/145 (73.10%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PL+KSE ++YL WA+++F+IT   V+D TQIHTHMCYS FN+II  I+ +D DVI+IE+SRSD +LL   +   K    IGPG+YDIHS   PS  EI D++ K+L  +  + LW+NPDCGLKTR + E++ +L+NMV AAK LR
Sbjct:  618 PLKKSEQSYYLKWAINTFKITVSSVKDNTQIHTHMCYSEFNEIIDDILKLDVDVISIESSRSDLQLLQFIKTAGKKLNEIGPGIYDIHSIHQPSINEIMDKLKKLLQYIPKDRLWINPDCGLKTRSWNEIRESLNNMVIAAKTLR 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_XYLFT (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metE PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.777e-41
Identity = 86/147 (58.50%), Postives = 103/147 (70.07%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PLR+ E A YL+WAV SFRI +  V DTTQIHTHMCYS FNDII ++  +DADVI+IE SRS  +LL  F +  +Y   IGPGVYDIHSPR+P  EE+   + K  AVL    LWVNPDCGLKTR + E + AL  MV AA+ LR +
Sbjct:  613 PLRRGEWADYLNWAVESFRIASSNVHDTTQIHTHMCYSEFNDIIEAVAALDADVISIETSRSRMELLDAFVK-FRYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPPEQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_XYLFM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M12) GN=metE PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.777e-41
Identity = 86/147 (58.50%), Postives = 103/147 (70.07%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PLR+ E A YL+WAV SFRI +  V DTTQIHTHMCYS FNDII ++  +DADVI+IE SRS  +LL  F +  +Y   IGPGVYDIHSPR+P  EE+   + K  AVL    LWVNPDCGLKTR + E + AL  MV AA+ LR +
Sbjct:  613 PLRRGEWADYLNWAVESFRIASSNVHDTTQIHTHMCYSEFNDIIEAVAALDADVISIETSRSRMELLDAFVK-FRYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPPEQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_XYLF2 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Xylella fastidiosa (strain M23) GN=metE PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.777e-41
Identity = 86/147 (58.50%), Postives = 103/147 (70.07%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PLR+ E A YL+WAV SFRI +  V DTTQIHTHMCYS FNDII ++  +DADVI+IE SRS  +LL  F +  +Y   IGPGVYDIHSPR+P  EE+   + K  AVL    LWVNPDCGLKTR + E + AL  MV AA+ LR +
Sbjct:  613 PLRRGEWADYLNWAVESFRIASSNVHDTTQIHTHMCYSEFNDIIEAVAALDADVISIETSRSRMELLDAFVK-FRYPNAIGPGVYDIHSPRVPQEEEMVLLLKKARAVLPPEQLWVNPDCGLKTRGWKETRAALQTMVHAAQRLRAE 758          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_VIBVU4.675e-4257.055-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEPW6.106e-4260.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEF57.975e-4257.055-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_MESSB7.975e-4257.935-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBVY1.042e-4156.385-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_XYLFA1.360e-4158.505-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BLOFL1.360e-4154.485-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_XYLFT1.777e-4158.505-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_XYLFM1.777e-4158.505-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_XYLF21.777e-4158.505-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top