DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RHOPT (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=metE PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.320e-41
Identity = 87/145 (60.00%), Postives = 102/145 (70.34%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+SE   YLDWAV  FR+ + GV+D TQIHTHMCYS FNDII +I  MDADVI+IE SRS  +LL  F+   KY   IGPGVYDIHSPR+PS EE+   +      L    LWVNPDCGLKTR + EV+ AL NMV AA+ +R
Sbjct:  640 PLRRSEWKGYLDWAVECFRLCSSGVKDETQIHTHMCYSEFNDIIDAIAAMDADVISIETSRSKMELLDAFKT-YKYPNEIGPGVYDIHSPRVPSVEEMTTLLQLARQRLSDGQLWVNPDCGLKTRGWDEVQGALVNMVEAARQIR 783          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RHOPA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris GN=metE PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.320e-41
Identity = 87/145 (60.00%), Postives = 102/145 (70.34%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+SE   YLDWAV  FR+ + GV+D TQIHTHMCYS FNDII +I  MDADVI+IE SRS  +LL  F+   KY   IGPGVYDIHSPR+PS EE+   +      L    LWVNPDCGLKTR + EV+ AL NMV AA+ +R
Sbjct:  640 PLRRSEWKGYLDWAVECFRLCSSGVKDETQIHTHMCYSEFNDIIDAIAAMDADVISIETSRSKMELLDAFKT-YKYPNEIGPGVYDIHSPRVPSVEEMTTLLQLARQRLSDGQLWVNPDCGLKTRGWDEVQGALVNMVEAARQIR 783          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBPA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio parahaemolyticus GN=metE PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.751e-41
Identity = 83/149 (55.70%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL+K +H  YL+WAV++F+I+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IP+ E I   I K    +    LWVNPDCGLKTR + E + AL+N+V+AAK LR +LA
Sbjct:  613 PLKKRDHKAYLEWAVNAFKISAASAKPETQIHTHMCYSEFNEIIDSVAALDADVITIETSRSNMELLKAFEE-FNYPNEIGPGVYDIHSPNIPTEEWIEGLIKKAAEKIPVQRLWVNPDCGLKTRNWAETEAALANLVSAAKKLRAELA 760          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_SHEON (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Shewanella oneidensis GN=metE PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.751e-41
Identity = 86/148 (58.11%), Postives = 103/148 (69.59%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PL++SE   YLDWAV++F+++  GV D TQIHTHMCYS FND I +I  MDADVITIE SRS  +LL+ F E  +Y   IGPGVYDIHSP  PS E +   I K    +    LWVNPDCGLKTR + EV+PAL NMV A + LR +L
Sbjct:  613 PLKQSEWQAYLDWAVNAFKLSAAGVVDETQIHTHMCYSEFNDTIAAIAAMDADVITIETSRSRMELLNAF-EDFEYPNEIGPGVYDIHSPNTPSVEAMVHLIEKAAQKVPVRQLWVNPDCGLKTRTWDEVEPALKNMVDATRELRRRL 759          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PSEE4 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Pseudomonas entomophila (strain L48) GN=metE PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.751e-41
Identity = 85/145 (58.62%), Postives = 100/145 (68.97%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+S    YL+WA  +FR+    V+D TQIHTHMCYS FND+I SI  MDADVITIE SRSD +LL  F E   Y   IGPGVYDIHSPR+P+ EE+   + K    +    LWVNPDCGLKTR + E + AL NMVAAA+ LR
Sbjct:  616 PLRRSAWPHYLEWATEAFRLCASDVRDETQIHTHMCYSEFNDVIESIAAMDADVITIETSRSDMELLEAF-ERFDYPNEIGPGVYDIHSPRVPTKEEMVKLLRKAAQRIPAERLWVNPDCGLKTRAWPETEAALVNMVAAARELR 759          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURXL (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia xenovorans (strain LB400) GN=metE PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.751e-41
Identity = 85/150 (56.67%), Postives = 104/150 (69.33%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR+++ A YL+WA  +FRI+  GV D TQIHTHMCYS FNDI+ SI  MDADVITIE SRS  +LL  F     Y   IGPGVYDIHSPR+P  + +   + +   V+    LWVNPDCGLKTR + E + AL+NMV AAK LR +LA+
Sbjct:  608 PLRRADWAAYLEWATRAFRISAAGVADQTQIHTHMCYSEFNDILPSIAAMDADVITIETSRSAMELLDGF-GAFAYPNEIGPGVYDIHSPRVPGADAMQRLLERACEVIPAERLWVNPDCGLKTRGWPETEAALANMVRAAKALRAKLAA 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RHILO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhizobium loti GN=metE PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 8.817e-41
Identity = 85/151 (56.29%), Postives = 104/151 (68.87%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASA 453
            PLR+++   YLDWAV  FR+ +  V D TQIHTHMCYS F DI+ +I  MDADVI+IE SRS  +LL   R   KY   IGPGVYDIHSPR+P   EI++ I      L    LWVNPDCGLKTR++ EV+PAL NMVAAA+ +R +  +A
Sbjct:  627 PLREADWQAYLDWAVECFRLASTAVGDATQIHTHMCYSEFGDIVDAIAAMDADVISIETSRSQLELLDTLRT-FKYPNEIGPGVYDIHSPRVPEVGEISNLIMLARKRLSDGQLWVNPDCGLKTRRWEEVRPALVNMVAAARAIRQKAQTA 776          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBFM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio fischeri (strain MJ11) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 85/150 (56.67%), Postives = 101/150 (67.33%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            P++KS+   YLDWAV +F+I+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IPS E I D I    A +    LWVNPDCGLKTR + E + AL NMV AAK LR +  S
Sbjct:  623 PIKKSDQKAYLDWAVEAFKISAASAKSETQIHTHMCYSEFNEIIESVAALDADVITIETSRSNMELLKAF-EDFNYPNEIGPGVYDIHSPNIPSQEWIVDLIETAAARVPVERLWVNPDCGLKTRNWKETEAALENMVKAAKALRKKWQS 771          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBF1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 85/150 (56.67%), Postives = 101/150 (67.33%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            P++KS+   YLDWAV +F+I+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IPS E I D I    A +    LWVNPDCGLKTR + E + AL NMV AAK LR +  S
Sbjct:  623 PIKKSDQKAYLDWAVEAFKISAASAKSETQIHTHMCYSEFNEIIESVAALDADVITIETSRSNMELLKAF-EDFNYPNEIGPGVYDIHSPNIPSQEWIVDLIETAAARVPVERLWVNPDCGLKTRNWKETEAALENMVKAAKALRKKWQS 771          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_STAES (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 85/150 (56.67%), Postives = 102/150 (68.00%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR   H  YL+ AVHSF++    V D TQIHTHMCYS F  IIH+I D+DADVI+IE SRS   L+  F E + Y  GIG GVYDIHSPRIP+ EEI   IN+ L  ++ ++ WVNPDCGLKTRK  EVK AL+ +V A K  R +  S
Sbjct:  597 PLRSEYHEQYLEDAVHSFKLATSSVHDETQIHTHMCYSQFGQIIHAIHDLDADVISIETSRSHGDLIQDF-EDINYDLGIGLGVYDIHSPRIPTEEEITTAINRSLQQIDRSLFWVNPDCGLKTRKENEVKDALTVLVNAVKKKRQESES 745          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_RHOPT2.320e-4160.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RHOPA2.320e-4160.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBPA6.751e-4155.705-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_SHEON6.751e-4158.115-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PSEE46.751e-4158.625-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURXL6.751e-4156.675-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RHILO8.817e-4156.295-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBFM1.152e-4056.675-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBF11.152e-4056.675-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_STAES1.152e-4056.675-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top