DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_STAEQ (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 85/150 (56.67%), Postives = 102/150 (68.00%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR   H  YL+ AVHSF++    V D TQIHTHMCYS F  IIH+I D+DADVI+IE SRS   L+  F E + Y  GIG GVYDIHSPRIP+ EEI   IN+ L  ++ ++ WVNPDCGLKTRK  EVK AL+ +V A K  R +  S
Sbjct:  597 PLRSEYHEQYLEDAVHSFKLATSSVHDETQIHTHMCYSQFGQIIHAIHDLDADVISIETSRSHGDLIQDF-EDINYDLGIGLGVYDIHSPRIPTEEEITTAINRSLQQIDRSLFWVNPDCGLKTRKENEVKDALTVLVNAVKKKRQESES 745          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RALEU (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia eutropha GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 83/150 (55.33%), Postives = 109/150 (72.67%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR+++   YLDWAV +FR++  GVQD TQIHTHMCY+ FNDI+ +I  MDADVITIE SRS  +LL  F +   Y   IGPGVYDIHSPR+PS + +   +++   V+    LWVNPDCGLKTR + E + AL+NMV+AA+ LR +L++
Sbjct:  609 PLRRADWDAYLDWAVTAFRLSASGVQDQTQIHTHMCYAEFNDILPAIAAMDADVITIETSRSAMELLEGFGD-FDYPNEIGPGVYDIHSPRVPSVQAMERLLDRACEVVPPQRLWVNPDCGLKTRGWEETEAALANMVSAARALRARLSA 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RALEH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 83/150 (55.33%), Postives = 109/150 (72.67%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR+++   YLDWAV +FR++  GVQD TQIHTHMCY+ FNDI+ +I  MDADVITIE SRS  +LL  F +   Y   IGPGVYDIHSPR+PS + +   +++   V+    LWVNPDCGLKTR + E + AL+NMV+AA+ LR +L++
Sbjct:  609 PLRRADWDAYLDWAVTAFRLSASGVQDQTQIHTHMCYAEFNDILPAIAAMDADVITIETSRSAMELLEGFGD-FDYPNEIGPGVYDIHSPRVPSVQAMERLLDRACEVVPPQRLWVNPDCGLKTRGWEETEAALANMVSAARALRARLSA 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_NITEU (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrosomonas europaea GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 81/148 (54.73%), Postives = 103/148 (69.59%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLRK +   YLDWAV +FR+ + GV+D TQIHTHMCYS F+DI+ +I ++DADVITIE SRS  +LL  F +   Y   IGPGVYDIHSPR+P   E+ + + K    ++  +LWVNPDCGLKTR + E + AL  MV  AK LR+ L
Sbjct:  610 PLRKQDWKSYLDWAVKAFRVASSGVKDETQIHTHMCYSEFHDILPAIAELDADVITIETSRSRMELLDAFVK-FSYPNEIGPGVYDIHSPRVPDASEMFELLKKASRYIDPTLLWVNPDCGLKTRNWPETQTALQKMVDCAKTLRSAL 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_HAEIN (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 83/149 (55.70%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++++   YL WA  +FR+++ GVQD TQIHTHMCYS FNDI+ +I  +DADVITIE SRSD +LL+ F +  KY   IGPGVYDIHSPR+P+  E+   + K L V+    LWVNPDCGLKTR +TE    L  MV   K LR +LA
Sbjct:  609 PLKRADWDAYLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDADVITIETSRSDMELLTAFAD-FKYPNDIGPGVYDIHSPRVPTATEVEHLLRKALNVIPKERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_HAEIG (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain PittGG) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 83/149 (55.70%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++++   YL WA  +FR+++ GVQD TQIHTHMCYS FNDI+ +I  +DADVITIE SRSD +LL+ F +  KY   IGPGVYDIHSPR+P+  E+   + K L V+    LWVNPDCGLKTR +TE    L  MV   K LR +LA
Sbjct:  609 PLKRADWDAYLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDADVITIETSRSDMELLTAFAD-FKYPNDIGPGVYDIHSPRVPTATEVEHLLRKALNVIPKERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_HAEIE (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus influenzae (strain PittEE) GN=metE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.152e-40
Identity = 83/149 (55.70%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++++   YL WA  +FR+++ GVQD TQIHTHMCYS FNDI+ +I  +DADVITIE SRSD +LL+ F +  KY   IGPGVYDIHSPR+P+  E+   + K L V+    LWVNPDCGLKTR +TE    L  MV   K LR +LA
Sbjct:  609 PLKRADWDAYLQWAGEAFRLSSMGVQDDTQIHTHMCYSEFNDILPAIAALDADVITIETSRSDMELLTAFAD-FKYPNDIGPGVYDIHSPRVPTAAEVEHLLRKALNVIPKERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRAELA 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBHA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio harveyi GN=metE PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.504e-40
Identity = 83/148 (56.08%), Postives = 102/148 (68.92%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PL+K +H  YL WAV +F+I     +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IPS E I + I K    +    LWVNPDCGLKTR ++E + AL+N+V+AAK LR +L
Sbjct:  613 PLKKRDHKAYLQWAVDAFKIAAASAKPETQIHTHMCYSEFNEIIDSVAALDADVITIETSRSNMELLKAF-EDFNYPNEIGPGVYDIHSPNIPSEEWIEELIKKAAEKIPAQRLWVNPDCGLKTRNWSETEAALANLVSAAKKLRAEL 759          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_NITOC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metE PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.504e-40
Identity = 85/146 (58.22%), Postives = 101/146 (69.18%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRT 438
            PLR+ E   YL WAV  FR+ + GV+D TQIHTHMCYS FNDIIH+I  +DADVITIE SRSD +LL+ F    +Y   IGPGVYDIHSP +P+  +I   I K    +    LWVNPDCGLKTR + EV+ AL  MVAAA  LR+
Sbjct:  613 PLRRVEWESYLAWAVRCFRVASSGVEDGTQIHTHMCYSEFNDIIHAIAALDADVITIETSRSDGELLAAF-AAFEYPNEIGPGVYDIHSPVVPTEAQIVGLIKKAAEYIPAERLWVNPDCGLKTRAWPEVETALRTMVAAAHGLRS 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_METCA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Methylococcus capsulatus GN=metE PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.504e-40
Identity = 81/145 (55.86%), Postives = 102/145 (70.34%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PL+ ++ A YLDWAV +FR+ +CGV D TQIHTHMCYS F DI+ +I ++DADVITIE  RS   LL  F     Y   IGPGVYDIHSPR+P+  EI   + K  A ++   LWVNPDCGLKTR++ E + AL+NMV AA+ +R
Sbjct:  609 PLKAADRADYLDWAVKAFRLASCGVADDTQIHTHMCYSEFGDILPAIAELDADVITIETCRSAMDLLEAF-GAFGYPNDIGPGVYDIHSPRVPAGAEIRALLEKAAAAVDPERLWVNPDCGLKTRQWPEAEQALANMVEAARAMR 752          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_STAEQ1.152e-4056.675-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RALEU1.152e-4055.335-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RALEH1.152e-4055.335-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_NITEU1.152e-4054.735-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_HAEIN1.152e-4055.705-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_HAEIG1.152e-4055.705-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_HAEIE1.152e-4055.705-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBHA1.504e-4056.085-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_NITOC1.504e-4058.225-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_METCA1.504e-4055.865-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top