DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_AERS4 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Aeromonas salmonicida (strain A449) GN=metE PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.504e-40
Identity = 86/149 (57.72%), Postives = 102/149 (68.46%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLRK +H  YLDWAV +FR++   V D+TQIHTHMCYS+FN II ++  +DADVITIE SRS  +LL  F E   Y   IGPGVYDIHSP +PS   I D I K    +  + LWVNPDCGLKTR + E + AL  MV A K LRT+LA
Sbjct:  607 PLRKQDHQAYLDWAVRAFRLSASPVVDSTQIHTHMCYSDFNLIIEAVAALDADVITIETSRSQMQLLEAF-ERFNYPNEIGPGVYDIHSPNVPSQGWIEDLIRKAAKQIPADRLWVNPDCGLKTRGWEETEAALKVMVNATKALRTELA 754          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBCH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio cholerae GN=metE PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.964e-40
Identity = 83/147 (56.46%), Postives = 101/147 (68.71%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PL+K +H  YLDWAV +F+I+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IP+   I D + K    +    LWVNPDCGLKTR + EV+ AL+NMV AAK LR +
Sbjct:  613 PLKKRDHQTYLDWAVQAFKISAGSARPETQIHTHMCYSEFNEIIESVAALDADVITIETSRSNMELLKAFEE-FNYPNEIGPGVYDIHSPNIPAQAWIEDLLRKAAEKIPAQRLWVNPDCGLKTRNWPEVEAALTNMVNAAKALRAE 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURPP (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=metE PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.964e-40
Identity = 85/150 (56.67%), Postives = 102/150 (68.00%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAS 450
            PLR+ + A YL+WA   FRI+  GV D TQIHTHMCYS FNDI+ SI  MDADVITIE SRS  +LL  F     Y   IGPGVYDIHSPR+P  + +   + +   V+    LWVNPDCGLKTR + E + AL+NMV AAK LR +LA+
Sbjct:  608 PLRRGDWAAYLEWATRVFRISAAGVADQTQIHTHMCYSEFNDILPSIAAMDADVITIETSRSAMELLDGF-GAFAYPNEIGPGVYDIHSPRVPDAQAMQRLLERACEVIPAERLWVNPDCGLKTRGWPETEAALTNMVRAAKALRAKLAA 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BUCBP (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=metE PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.964e-40
Identity = 85/148 (57.43%), Postives = 104/148 (70.27%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR S    YL WAV SF++++ GV D TQIHTHMCY  FNDI+++I+ +DADVITIE SRSD +LL  F+E  KY   IGPGVYDIHSP IPS E I   + + +  +    LWVNPDCGLKTR + E   +L NMV AAK+LR +L
Sbjct:  610 PLRLSLRNEYLSWAVDSFKLSSSGVCDETQIHTHMCYCEFNDIMNAIVLLDADVITIETSRSDMELLEFFKE-FKYPNDIGPGVYDIHSPNIPSIEWIMTLLRQAMHYIPVKRLWVNPDCGLKTRTWDETYYSLENMVRAAKILRKKL 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BIFAA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083) GN=metE PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.964e-40
Identity = 83/150 (55.33%), Postives = 105/150 (70.00%), Query Frame = 1
Query:    1 PLRKSE-HAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLRK++ H  YLDWA+ +FR+ +  V+ TTQIHTHMCYS FNDII  I  MDADVI+ E SR D  +L    +   +    GPGVYDIHSPRIPS +EI DRI ++L  ++   +W+NPDCGLKTR   E  P+L N+VAAAK +R +LA
Sbjct:  619 PLRKTDWHKKYLDWAIPAFRLVHSAVKPTTQIHTHMCYSEFNDIIKDIDAMDADVISFEASRGDLVVLDAIHDA-NFETEAGPGVYDIHSPRIPSEQEIEDRIYEILKKMDVEKVWINPDCGLKTRGNAETWPSLENLVAAAKAVRAKLA 767          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_VIBHB (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=metE PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.565e-40
Identity = 83/149 (55.70%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL+K +H  YL WAV +F+I+    +  TQIHTHMCYS FN+II S+  +DADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP IP+ E I   + K    +    LWVNPDCGLKTR + E + AL+N+V+AAK LRT+LA
Sbjct:  613 PLKKRDHDAYLQWAVDAFKISAASAKPETQIHTHMCYSEFNEIIDSVAALDADVITIETSRSNMELLKAF-EAFNYPNEIGPGVYDIHSPNIPTQEWIEALLKKAAEKVPVQRLWVNPDCGLKTRNWDETEAALANLVSAAKKLRTELA 760          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_CHRSD (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metE PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.565e-40
Identity = 84/145 (57.93%), Postives = 101/145 (69.66%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+ E   YLDWAV SF+++    +D TQIHTHMCYS FNDII +I  +DADVITIE SRSD +LL  F++   Y   IGPGVYDIHSP IP  E +   + K    +    LWVNPDCGLKTR + EV+PAL+NMV AA+ LR
Sbjct:  614 PLRQGEWQEYLDWAVKSFKLSAAVARDETQIHTHMCYSEFNDIIAAIAALDADVITIETSRSDMELLDAFQD-FAYPNEIGPGVYDIHSPNIPEVEWMVSLMEKAAEKIPAERLWVNPDCGLKTRGWAEVEPALANMVEAARELR 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BUCCC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Cinara cedri GN=metE PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.565e-40
Identity = 83/147 (56.46%), Postives = 101/147 (68.71%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PLR  E   YL WAV SF+I + GV+++TQIHTHMCY  FNDI+ +I+D+DADVITIE SRSD +LL  F+   KY   IGPGVYDIHSP IPS + I   + K L  +    LWVNPDCGLKTR +TE   AL NM+ A   +R +
Sbjct:  611 PLRTHEWNNYLRWAVKSFKICSSGVKNSTQIHTHMCYCEFNDIMPAIVDLDADVITIETSRSDMELLEFFKT-FKYPNAIGPGVYDIHSPNIPSVQSIEKLLKKALKYISIQQLWVNPDCGLKTRNWTETSLALQNMLQATLNIRKE 756          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BIFLO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum GN=metE PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.565e-40
Identity = 84/149 (56.38%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSE-HAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLRKS+ H  YLDWAV +FR+ +  V+ TTQIHTHMCYS FNDII  I  MDADVI+ E SR D  +L    +   +    GPGVYDIHSPRIPS +EI DRI ++L  ++   +W+NPDCGLKTR   E  P+L N+VAAAK +R +L
Sbjct:  618 PLRKSDWHVKYLDWAVPAFRLVHSAVKPTTQIHTHMCYSEFNDIIRDIDAMDADVISFEASRGDLVVLDAIHDA-HFETEAGPGVYDIHSPRIPSEKEIEDRIYEILDKMDVKKVWINPDCGLKTRGNAETWPSLENLVAAAKAVRAKL 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BIFLI (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / NCTC 11817 / S12) GN=metE PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.565e-40
Identity = 83/149 (55.70%), Postives = 106/149 (71.14%), Query Frame = 1
Query:    1 PLRKSE-HAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLRKS+ HA YLDWA+ +FR+ +  V+ TTQIHTHMCYS FNDII  I  MDADVI+ E SR D  +L    +  ++    GPGVYDIHSPRIPS +EI DRI ++L  ++   +W+NPDCGLKTR   E  P+L ++VAAAK +R +L
Sbjct:  618 PLRKSDWHAKYLDWAIPAFRLVHSAVKPTTQIHTHMCYSEFNDIIRDIDAMDADVISFEASRGDLVVLDAIHDA-RFETEAGPGVYDIHSPRIPSEKEIEDRIYEILDKIDVKKVWINPDCGLKTRGNDETWPSLEHLVAAAKAVRARL 765          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_AERS41.504e-4057.725-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBCH1.964e-4056.465-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURPP1.964e-4056.675-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BUCBP1.964e-4057.435-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BIFAA1.964e-4055.335-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_VIBHB2.565e-4055.705-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CHRSD2.565e-4057.935-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BUCCC2.565e-4056.465-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BIFLO2.565e-4056.385-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BIFLI2.565e-4055.705-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top