DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BIFLD (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=metE PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.565e-40
Identity = 84/149 (56.38%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSE-HAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLRKS+ H  YLDWAV +FR+ +  V+ TTQIHTHMCYS FNDII  I  MDADVI+ E SR D  +L    +   +    GPGVYDIHSPRIPS +EI DRI ++L  ++   +W+NPDCGLKTR   E  P+L N+VAAAK +R +L
Sbjct:  618 PLRKSDWHVKYLDWAVPAFRLVHSAVKPTTQIHTHMCYSEFNDIIRDIDAMDADVISFEASRGDLVVLDAIHDA-HFETEAGPGVYDIHSPRIPSEKEIEDRIYEILDKMDVKKVWINPDCGLKTRGNAETWPSLENLVAAAKAVRAKL 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RALPJ (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia pickettii (strain 12J) GN=metE PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.351e-40
Identity = 83/152 (54.61%), Postives = 105/152 (69.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLR S+   YL+WA  +FR++  GV++ TQIHTHMCYS FNDI+ +I  MDADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSPR+P  +E+   ++K   V+    LWVNPDCGLKTR + EV+ AL  +V A   LR + A+AK
Sbjct:  612 PLRASDVPTYLEWAARAFRVSASGVRNDTQIHTHMCYSEFNDILPAIASMDADVITIETSRSNMELLDAFAE-FAYPNEIGPGVYDIHSPRVPRVDEMESLLDKAAQVVPVQRLWVNPDCGLKTRGWPEVEAALQGIVEATHRLRAKHANAK 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_RALSO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Ralstonia solanacearum GN=metE PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.376e-40
Identity = 84/151 (55.63%), Postives = 103/151 (68.21%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASA 453
            PLR  + A YL+WA   FR++  GV++ TQIHTHMCYS FNDI+ +I  MDADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSPR+P  EE+   ++K   V+    LWVNPDCGLKTR + EV+ AL  MV A + LR + A A
Sbjct:  609 PLRAGDVAVYLEWAARVFRVSASGVRNDTQIHTHMCYSEFNDILPAIASMDADVITIETSRSNMELLDAFGE-FAYPNEIGPGVYDIHSPRVPRVEEMEALLDKAAQVVPVQRLWVNPDCGLKTRGWPEVEAALRGMVEATRRLRARHAGA 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_HAES2 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus somnus (strain 2336) GN=metE PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.376e-40
Identity = 82/149 (55.03%), Postives = 105/149 (70.47%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++++   YL WA  +FR+++ GV D TQIHTHMCYS FNDI+ +I  +DADVITIE SRSD +LL+ F +  KY   IGPGVYDIHSPR+P+ EEI   + K L V+    LWVNPDCGLKTR ++E    L  M++  K LR +LA
Sbjct:  610 PLKRADWDTYLQWAGEAFRLSSMGVADDTQIHTHMCYSEFNDILPAIAALDADVITIETSRSDMELLTAFGD-FKYPNDIGPGVYDIHSPRVPTAEEIEHLLRKALNVVPKERLWVNPDCGLKTRGWSETIAQLEVMMSVTKKLRAELA 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_HAES1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=metE PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.376e-40
Identity = 82/149 (55.03%), Postives = 105/149 (70.47%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++++   YL WA  +FR+++ GV D TQIHTHMCYS FNDI+ +I  +DADVITIE SRSD +LL+ F +  KY   IGPGVYDIHSPR+P+ EEI   + K L V+    LWVNPDCGLKTR ++E    L  M++  K LR +LA
Sbjct:  610 PLKRADWDTYLQWAGEAFRLSSMGVADDTQIHTHMCYSEFNDILPAIAALDADVITIETSRSDMELLTAFGD-FKYPNDIGPGVYDIHSPRVPTAEEIEHLLRKALNVVPKERLWVNPDCGLKTRGWSETIAQLEVMMSVTKKLRAELA 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_CHRVO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromobacterium violaceum GN=metE PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.715e-40
Identity = 84/151 (55.63%), Postives = 105/151 (69.54%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASA 453
            PL+++    YL WA  +FR+++ GV D TQIHTHMCYS F DI+ +I  +DADVITIE SRSD  LL+ F    +Y   IGPGVYDIHSPR+PS  EI   ++K L V+    LWVNPDCGLKTR + EV+ AL+ MVA  + LR +LA A
Sbjct:  610 PLKRAGRDVYLAWAGEAFRLSSRGVDDATQIHTHMCYSEFGDILPAIAALDADVITIETSRSDMALLADFGR-FRYPNAIGPGVYDIHSPRVPSAAEIRALLDKALRVIPAERLWVNPDCGLKTRGWPEVEAALAAMVAVGRELREKLAQA 759          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BACP2 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=metE PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.715e-40
Identity = 84/149 (56.38%), Postives = 106/149 (71.14%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++S+ A YL+WA  SFR++   VQ+ TQIHTHMCYSNF DI+ +I D+DADVITIE+SRS    L  + E   Y  G+G GVYDIHSPR+PS EE++  I+  L V  T+  WVNPDCGLKTR+  E   AL NMV AA++ R +LA
Sbjct:  612 PLKESDWADYLNWAAESFRLSTSSVQNETQIHTHMCYSNFEDIVDTIEDLDADVITIEHSRSHGGFLD-YLEKHPYLKGLGLGVYDIHSPRVPSVEEMSQIIDDALNVCPTDRFWVNPDCGLKTRQEPETIAALKNMVTAAEVARKKLA 759          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BORPE (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella pertussis GN=metE PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.464e-40
Identity = 83/145 (57.24%), Postives = 99/145 (68.28%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+++   YLDWAV  FR++  GV + TQIHTHMCYS FNDII SI  MDADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP +P  + + + + K  A L    LWVNPDCGLKTR + E + AL  MV AA+ LR
Sbjct:  619 PLRRADWRAYLDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDADVITIETSRSNMELLKAF-EDFHYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPKERLWVNPDCGLKTRAWPETEAALIGMVQAARTLR 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BORPA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella parapertussis GN=metE PE=3 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 7.464e-40
Identity = 83/145 (57.24%), Postives = 99/145 (68.28%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+++   YLDWAV  FR++  GV + TQIHTHMCYS FNDII SI  MDADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP +P  + + + + K  A L    LWVNPDCGLKTR + E + AL  MV AA+ LR
Sbjct:  619 PLRRADWRAYLDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDADVITIETSRSNMELLKAF-EDFHYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPKERLWVNPDCGLKTRAWPETEAALIGMVQAARTLR 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BORBR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella bronchiseptica GN=metE PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.464e-40
Identity = 83/145 (57.24%), Postives = 99/145 (68.28%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+++   YLDWAV  FR++  GV + TQIHTHMCYS FNDII SI  MDADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP +P  + + + + K  A L    LWVNPDCGLKTR + E + AL  MV AA+ LR
Sbjct:  619 PLRRADWRAYLDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDADVITIETSRSNMELLKAF-EDFHYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPKERLWVNPDCGLKTRAWPETEAALIGMVQAARTLR 762          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_BIFLD2.565e-4056.385-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RALPJ3.351e-4054.615-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RALSO4.376e-4055.635-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_HAES24.376e-4055.035-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_HAES14.376e-4055.035-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CHRVO5.715e-4055.635-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BACP25.715e-4056.385-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BORPE7.464e-4057.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BORPA7.464e-4057.245-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BORBR7.464e-4057.245-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top