DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BORA1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella avium (strain 197N) GN=metE PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.464e-40
Identity = 84/145 (57.93%), Postives = 99/145 (68.28%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PLR+++   YLDWAV  FR++  GV D TQIHTHMCYS FNDII SI  MDADVITIE SRS+ +LL  F E   Y   IGPGVYDIHSP +P  + +   + K  A L    LWVNPDCGLKTR + E + AL +MV AA+ LR
Sbjct:  619 PLRRADWQAYLDWAVDCFRLSTAGVADDTQIHTHMCYSEFNDIIESIAAMDADVITIETSRSNMELLKAF-EDFHYPNDIGPGVYDIHSPNVPDVDWMVGLMQKAGANLSKERLWVNPDCGLKTRAWPETEAALISMVQAARTLR 762          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BAUCH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=metE PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.464e-40
Identity = 84/147 (57.14%), Postives = 101/147 (68.71%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PL+ S    YL WAV +FR+     ++ TQIHTHMCYS FNDI+ SII MDADVITIE SRS+ KLL  F++  +Y   IGPGVYDIHSP IPS ++I   + K   V+    LWVNPDCGLKTR + E + ALSNMV AA  LR +
Sbjct:  613 PLKYSAWKEYLTWAVEAFRLNAAVAKNNTQIHTHMCYSEFNDIMDSIIAMDADVITIETSRSNMKLLDTFKQ-YQYPNDIGPGVYDIHSPNIPSEDDIIQLLRKAAQVIPIKRLWVNPDCGLKTRTWLETRKALSNMVNAAHKLRRE 758          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BUCAP (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum GN=metE PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 9.749e-40
Identity = 83/148 (56.08%), Postives = 104/148 (70.27%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLRKS    YL WAV +FR+++ GV++TTQIHTHMCY  F+DI+H+I  +DADVITIE +RSD +LL  F+   KY   IGPGVYDIHS  IPS   I   +NK +A +    +WVNPDCGLKTR + E   AL NMV AAK +R ++
Sbjct:  607 PLRKSLWNEYLSWAVDAFRLSSSGVKNTTQIHTHMCYCEFHDIMHAISFLDADVITIETARSDMELLKSFKT-FKYPNEIGPGVYDIHSSNIPSITSIKFLLNKAIAYIPVERIWVNPDCGLKTRNWNETILALKNMVCAAKEMRDKI 753          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BACHD (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bacillus halodurans GN=metE PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 9.749e-40
Identity = 82/148 (55.41%), Postives = 104/148 (70.27%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PL+  +   YLDWAV +FR +   V+ TTQIHTHMCYS F+++I +I D+DADVI+IE SRS  +++S F E   Y  GIG GVYDIHSPR+PS EE+ + I + L VL  ++ WVNPDCGLKTR   E   AL NMVAAA+  R +L
Sbjct:  606 PLKAEDQQEYLDWAVSAFRASCAHVKATTQIHTHMCYSEFHEMIEAIDDLDADVISIETSRSHGEMISAF-EKTTYEKGIGLGVYDIHSPRVPSEEEMLNVIRRALTVLPASLFWVNPDCGLKTRAEKETVAALKNMVAAARAAREEL 752          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_ACIF5 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metE PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 9.749e-40
Identity = 81/147 (55.10%), Postives = 100/147 (68.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PL++ +   YL+WA  +FRI+     D  QIHTHMCYS FNDI+ +I  MDADVITIE SRS  +LL  F     Y   IGPGVYDIHSPR+PS EE+   + K + V+    LW+NPDCGLKTRK+ EV PAL NMV AA+ +R +
Sbjct:  637 PLKRKDWGHYLEWASRAFRISAQIAPDDVQIHTHMCYSEFNDILPAIAAMDADVITIETSRSQMELLDAFAT-FNYPNEIGPGVYDIHSPRVPSVEEMVGLMEKAVKVVPAERLWINPDCGLKTRKWAEVTPALENMVEAARQVRAR 782          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_ACIF2 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) GN=metE PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 9.749e-40
Identity = 81/147 (55.10%), Postives = 100/147 (68.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PL++ +   YL+WA  +FRI+     D  QIHTHMCYS FNDI+ +I  MDADVITIE SRS  +LL  F     Y   IGPGVYDIHSPR+PS EE+   + K + V+    LW+NPDCGLKTRK+ EV PAL NMV AA+ +R +
Sbjct:  637 PLKRKDWGHYLEWASRAFRISAQIAPDDVQIHTHMCYSEFNDILPAIAAMDADVITIETSRSQMELLDAFAT-FNYPNEIGPGVYDIHSPRVPSVEEMVGLMEKAVKVVPAERLWINPDCGLKTRKWAEVTPALENMVEAARQVRAR 782          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_NEIG1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metE PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.273e-39
Identity = 80/149 (53.69%), Postives = 104/149 (69.80%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PL++++   YL+WA  SFR+++ G +D+TQIHTHMCYS FNDI+ +I  MDADVITIE SRSD +LL+ F E  KY   IGPGVYDIHSPR+P+  E+   + K + V+    LWVNPDCGLKTR + E    L  M+   + LR +LA
Sbjct:  610 PLKRADWDAYLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMDADVITIETSRSDMELLAAFGE-FKYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPVERLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELA 757          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BIFA0 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=metE PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.273e-39
Identity = 82/149 (55.03%), Postives = 103/149 (69.13%), Query Frame = 1
Query:    1 PLRKSE-HAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+S+ H  YLDWA+ +FR+ +  VQ +TQIHTHMCYS FNDII  I  MDADVI+ E SR D  +L    +   +    GPGVYDIHSPRIPS EE  +RI + LA ++ N +W+NPDCGLKTR   E  P+L++MV AAK +R  L
Sbjct:  619 PLRESDWHREYLDWAIPAFRLVHSAVQPSTQIHTHMCYSEFNDIISDIDAMDADVISFEASRGDLVVLDAIHDA-HFETEAGPGVYDIHSPRIPSVEETEERIGESLAKMDVNKVWINPDCGLKTRGNDETWPSLTHMVQAAKAMRANL 766          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_THEYD (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=metE PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.663e-39
Identity = 76/145 (52.41%), Postives = 105/145 (72.41%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLR 435
            PL++++   Y DW ++SFR+T   V   TQIHTHMCYS+FN+II  I  +DADVI+IE SRS  ++LS F E  +Y  GIG GVYDIHSPR+PS EE+ + I + +++++ ++ W+NPDCGLKTR + E   +L NMV AAK +R
Sbjct:  598 PLKRNKQDEYFDWTINSFRLTTADVSPFTQIHTHMCYSDFNEIIDRIYALDADVISIEASRSKGEILSAF-ENFRYDHGIGLGVYDIHSPRVPSVEEMIEIIERSVSLIDKSLFWINPDCGLKTRGWQETVASLKNMVLAAKAMR 741          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_PHOPR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Photobacterium profundum GN=metE PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.663e-39
Identity = 81/147 (55.10%), Postives = 100/147 (68.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQ 441
            PL++S+   YLDWAV++F+I+    +  TQIHTHMCYS FN II S+  +DADVITIE SRSD +LL  F E   Y   IGPGVYDIHSP IPS E+I   + K   ++    LW+NPDCGLKTR + E + AL +MV A K LR Q
Sbjct:  615 PLKESQWQAYLDWAVNAFKISAASAEPQTQIHTHMCYSEFNHIIKSVAALDADVITIETSRSDMELLKAFEE-FDYPNEIGPGVYDIHSPNIPSIEQIVHLVEKAETLIPIERLWINPDCGLKTRNWEETEAALRSMVEATKKLREQ 760          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_BORA17.464e-4057.935-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BAUCH7.464e-4057.145-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BUCAP9.749e-4056.085-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BACHD9.749e-4055.415-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ACIF59.749e-4055.105-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ACIF29.749e-4055.105-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_NEIG11.273e-3953.695-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BIFA01.273e-3955.035-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_THEYD1.663e-3952.415-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_PHOPR1.663e-3955.105-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top