DC900062

Overview
NameDC900062
Unique NameDC900062
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length403
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5633 contig Csv1_Contig5633:1..403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFR1A_DANRE (Splicing factor, arginine/serine-rich 1A OS=Danio rerio GN=sfrs1a PE=2 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 8.088e-21
Identity = 49/86 (56.98%), Postives = 58/86 (67.44%), Query Frame = 2
Query:  140 SGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            +G     IY GNLP DIR  +VED+FYKYG I DI+LK     P + FVEFE+ RDAEDA+  RDGY++DG RLRVE    G G G
Sbjct:   10 AGSNDCRIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYARDGYDYDGYRLRVEFPRSGRGMG 95          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS9_MOUSE (Splicing factor, arginine/serine-rich 9 OS=Mus musculus GN=Sfrs9 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.380e-20
Identity = 50/88 (56.82%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  134 EMSGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            E  G     IY GNLPSD+RE ++EDLFYKYGRI +IELK       + FV FE+ RDAEDAI GR+GY++  CRLRVE      GRG
Sbjct:    8 ERGGEGDGRIYVGNLPSDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRG 95          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS9_RAT (Splicing factor, arginine/serine-rich 9 OS=Rattus norvegicus GN=Sfrs9 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.802e-20
Identity = 49/88 (55.68%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  134 EMSGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            E  G     IY GNLP+D+RE ++EDLFYKYGRI +IELK       + FV FE+ RDAEDAI GR+GY++  CRLRVE      GRG
Sbjct:    7 ERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRAYGGRG 94          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: SFRS9_HUMAN (Splicing factor, arginine/serine-rich 9 OS=Homo sapiens GN=SFRS9 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.073e-20
Identity = 49/88 (55.68%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  134 EMSGRFSXXIYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGSGRG 397
            E  G     IY GNLP+D+RE ++EDLFYKYGRI +IELK       + FV FE+ RDAEDAI GR+GY++  CRLRVE      GRG
Sbjct:    7 ERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRG 94          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: RSP6_CAEEL (Probable splicing factor, arginine/serine-rich 6 OS=Caenorhabditis elegans GN=rsp-6 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.786e-13
Identity = 38/83 (45.78%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  161 IYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELA----HGGSGRG 397
            +Y G LPSD    E+E++F ++GRI  +   +  RPP + FVE+++ RDAEDA+R  DG    G R RVEL+     GG GRG
Sbjct:    5 VYVGGLPSDATSQELEEIFDRFGRIRKVW--VARRPPGFAFVEYDDVRDAEDAVRALDGSRICGVRARVELSTGQRRGGGGRG 85          
BLAST of DC900062 vs. ExPASy Swiss-Prot
Match: RBP1_DROME (RNA-binding protein 1 OS=Drosophila melanogaster GN=Rbp1 PE=1 SV=3)

HSP 1 Score: 66.2402 bits (160), Expect = 5.810e-11
Identity = 34/76 (44.74%), Postives = 47/76 (61.84%), Query Frame = 2
Query:  161 IYXGNLPSDIREYEVEDLFYKYGRILDIELKIPPRPPCYCFVEFENARDAEDAIRGRDGYNFDGCRLRVELAHGGS 388
            +Y GNL S   ++E+E  F KYG + ++   +   PP + FVEFE+ RDAEDA R  DG    G R+RVE++ G S
Sbjct:   13 VYVGNLGSSASKHEIEGAFAKYGPLRNVW--VARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTRIRVEMSSGRS 86          
The following BLAST results are available for this feature:
BLAST of DC900062 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
SFR1A_DANRE8.088e-2156.98Splicing factor, arginine/serine-rich 1A OS=Danio ... [more]
SFRS9_MOUSE1.380e-2056.82Splicing factor, arginine/serine-rich 9 OS=Mus mus... [more]
SFRS9_RAT1.802e-2055.68Splicing factor, arginine/serine-rich 9 OS=Rattus ... [more]
SFRS9_HUMAN3.073e-2055.68Splicing factor, arginine/serine-rich 9 OS=Homo sa... [more]
RSP6_CAEEL2.786e-1345.78Probable splicing factor, arginine/serine-rich 6 O... [more]
RBP1_DROME5.810e-1144.74RNA-binding protein 1 OS=Drosophila melanogaster G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900062 VSS Citrus sinensis cDNA clone VS27Q68 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900062 ID=DC900062|Name=DC900062|organism=Citrus sinensis|type=EST|length=403bp
CTCATTTCTCTCTGGAGCTCTCCATCGGAAGCAGCGGTCGTTTTCGGTAA
GGACCGGCGGGTCGTCACGTGGTGGTTCAGCGACGCTTCTCCTGCTCATA
AATCTTCGTGAAATTTTATAGTCCTTACCATCAGAAATGAGTGGTCGTTT
TTCTTNTNCAATCTATGNTGGCAACCTGCCCTCTGATATAAGAGAATATG
AAGTTGAGGATCTCTTTTACAAGTATGGCCGTATATTGGATATTGAATTA
AAGATCCCCCCTCGCCCACCATGTTATTGTTTTGTTGAGTTTGAGAATGC
TCGTGATGCCGAAGATGCTATTAGAGGTCGTGATGGCTATAACTTTGATG
GTTGTCGTTTAAGGGTTGAGCTCGCCCATGGTGGTAGTGGTAGAGGTCCA
TCA
back to top