DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP_TRYBB (Cysteine proteinase OS=Trypanosoma brucei brucei PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.578e-11
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 1
Query:   25 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMER 231
            N P+++A++    +F  Y  GI T      LDHGV  VGY       YWI+KNSW + WGE GYIR+E+
Sbjct:  257 NGPLAIAVDAE--SFMDYNGGILTSCTSKQLDHGVLLVGYNDNSNPPYWIIKNSWSNMWGEDGYIRIEK 323          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATH_HUMAN (Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4)

HSP 1 Score: 70.4774 bits (171), Expect = 1.578e-11
Identity = 42/100 (42.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:    1 KALQKAVA-NQPVSVAIEGGGMAFQLYESGIFTG----RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +A+ +AVA   PVS A E     F +Y +GI++     +    ++H V AVGYG + G  YWIVKNSWG  WG  GY  +ER         CG+A  ASY
Sbjct:  237 EAMVEAVALYNPVSFAFEVT-QDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERG-----KNMCGLAACASY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP_TRYCR (Cruzipain OS=Trypanosoma cruzi PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.061e-11
Identity = 34/86 (39.53%), Postives = 47/86 (54.65%), Query Frame = 1
Query:   25 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEAS 282
            N PV+VA++    ++  Y  G+ T      LDHGV  VGY       YWI+KNSW + WGE GYIR+ +      + +C +  EAS
Sbjct:  254 NGPVAVAVDAS--SWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKG-----SNQCLVKEEAS 332          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATV_NPVEP (Viral cathepsin OS=Epiphyas postvittana nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.591e-11
Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 1
Query:   31 PVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAME 276
            P+ VAI+   +    YE GI        L+H V  VGYG E    YWI+KNSWG+ WGE G+ ++++NV       CGI  E
Sbjct:  241 PIPVAIDASDILN--YEQGIIKYCANNGLNHAVLLVGYGVENNVPYWILKNSWGTDWGEQGFFKIQQNV-----NACGIKNE 315          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: LMCPA_LEIME (Cysteine proteinase A OS=Leishmania mexicana GN=LMCPA PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.996e-11
Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   31 PVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRM 225
            PV+VA++     +QLY  G+ +     SL+HGV  VG+       YWIVKNSWGSSWGE GYIR+
Sbjct:  261 PVAVAVDA--TTWQLYFGGVVSLCLAWSLNHGVLIVGFNKNAKPPYWIVKNSWGSSWGEKGYIRL 323          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP1_LEIPI (Cysteine proteinase 1 OS=Leishmania pifanoi GN=CYS1 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 5.996e-11
Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 1
Query:   31 PVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRM 225
            PV+VA++     +QLY  G+ +     SL+HGV  VG+       YWIVKNSWGSSWGE GYIR+
Sbjct:  261 PVAVAVDA--TTWQLYFGGVVSLCLAWSLNHGVLIVGFNKNAKPPYWIVKNSWGSSWGEKGYIRL 323          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
CYSP_TRYBB1.578e-1144.93Cysteine proteinase OS=Trypanosoma brucei brucei P... [more]
CATH_HUMAN1.578e-1142.00Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4[more]
CYSP_TRYCR2.061e-1139.53Cruzipain OS=Trypanosoma cruzi PE=1 SV=1[more]
CATV_NPVEP4.591e-1141.46Viral cathepsin OS=Epiphyas postvittana nucleopoly... [more]
LMCPA_LEIME5.996e-1150.77Cysteine proteinase A OS=Leishmania mexicana GN=LM... [more]
CYSP1_LEIPI5.996e-1150.77Cysteine proteinase 1 OS=Leishmania pifanoi GN=CYS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top