DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.051e-27
Identity = 59/95 (62.11%), Postives = 70/95 (73.68%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ++L KA+A+QPVSVAIE  G  FQ Y+ G+F G+CGT LDHGV AVGYG+  G+DY IVKNSWG  WGE G+IRM+RN  G   G CGI   ASY
Sbjct:  257 ESLVKALAHQPVSVAIEASGRDFQFYKGGVFNGKCGTDLDHGVAAVGYGSSKGSDYVIVKNSWGPRWGEKGFIRMKRN-TGKPEGLCGINKMASY 350          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPGP1_ZINOF (Zingipain-1 OS=Zingiber officinale PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 7.794e-27
Identity = 58/95 (61.05%), Postives = 69/95 (72.63%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            K+LQKAVANQPVSV ++  G  FQLY +GIFTG C  S +H  T  G  TE   DYW VKNSWG +WGE GYIR+ERN+A + +GKCGIA+  SY
Sbjct:  121 KSLQKAVANQPVSVTMDAAGRDFQLYRNGIFTGSCNISANHYRTVGGRETENDKDYWTVKNSWGKNWGESGYIRVERNIAES-SGKCGIAISPSY 214          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 1.330e-26
Identity = 57/95 (60.00%), Postives = 68/95 (71.58%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            K+L KA+A+QP+SVAI+  G  FQ Y  G+F GRCG  LDHGV AVGYG+  G+DY IVKNSWG  WGE GYIR++RN  G   G CGI   AS+
Sbjct:  258 KSLLKALAHQPLSVAIDASGREFQFYSGGVFDGRCGVDLDHGVAAVGYGSSKGSDYIIVKNSWGPKWGEKGYIRLKRN-TGKPEGLCGINKMASF 351          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: PAPA2_CARPA (Chymopapain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 2.507e-25
Identity = 52/90 (57.78%), Postives = 66/90 (73.33%), Query Frame = 1
Query:   16 AVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            A+ANQP+SV +E GG  FQLY+SG+F G CGT LDH VTAVGYGT  G +Y I+KNSWG +WGE GY+R++R  +G   G CG+   + Y
Sbjct:  258 ALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQ-SGNSQGTCGVYKSSYY 346          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: PAPA3_CARPA (Caricain OS=Carica papaya PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 8.918e-23
Identity = 50/93 (53.76%), Postives = 62/93 (66.67%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            L  A+A QPVSV +E  G  FQLY+ GIF G CGT +DH VTAVGYG   G  Y ++KNSWG++WGE GYIR++R   G   G CG+   + Y
Sbjct:  253 LLNAIAKQPVSVVVESKGRPFQLYKGGIFEGPCGTKVDHAVTAVGYGKSGGKGYILIKNSWGTAWGEKGYIRIKR-APGNSPGVCGLYKSSYY 344          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: BROM1_ANACO (Fruit bromelain OS=Ananas comosus PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.165e-22
Identity = 49/92 (53.26%), Postives = 67/92 (72.83%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEX-GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAM 273
            +++  AV+NQP++  I+     FQ Y  G+F+G CGTSL+H +T +GYG +  G  YWIV+NSWGSSWGEGGY+RM R V+ + +G CGIAM
Sbjct:  240 RSMMYAVSNQPIAALIDASEN-FQYYNGGVFSGPCGTSLNHAITIIGYGQDSSGTKYWIVRNSWGSSWGEGGYVRMARGVSSS-SGVCGIAM 329          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: PAPA4_CARPA (Papaya proteinase 4 OS=Carica papaya PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 1.521e-22
Identity = 49/94 (52.13%), Postives = 61/94 (64.89%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +L  A+A+QPVSV +E  G  FQ Y+ GIF G CGT +DH VTAVGYG   G  Y ++KNSWG  WGE GYIR+ R  +G   G CG+   + Y
Sbjct:  252 SLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKSGGKGYILIKNSWGPGWGENGYIRI-RRASGNSPGVCGVYRSSYY 344          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP3_HOMAM (Digestive cysteine proteinase 3 OS=Homarus americanus GN=LCP3 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 9.860e-22
Identity = 55/98 (56.12%), Postives = 67/98 (68.37%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CG-TSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +ALQ+AV+   P+SVAI+    +FQ Y SG++  + C  T LDHGV AVGYGTE   DYW+VKNSWGSSWG+ GYI+M RN        CGIA E SY
Sbjct:  225 EALQEAVSGVGPISVAIDASHFSFQFYSSGVYYEQNCSPTFLDHGVLAVGYGTESTKDYWLVKNSWGSSWGDAGYIKMSRN----RDNNCGIASEPSY 318          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ANAN_ANACO (Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 9.860e-22
Identity = 47/91 (51.65%), Postives = 66/91 (72.53%), Query Frame = 1
Query:   16 AVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEX-GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AV+NQP++ A++  G  FQ Y+ G+FTG CGT L+H +  +GYG +  G  +WIV+NSWG+ WGEGGYIR+ R+V+ +  G CGIAM+  Y
Sbjct:  245 AVSNQPIAAALDASGN-FQHYKRGVFTGPCGTRLNHAIVIIGYGQDSSGKKFWIVRNSWGAGWGEGGYIRLARDVSSSF-GLCGIAMDPLY 333          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: MDO1_PSEMR (Macrodontain-1 OS=Pseudananas macrodontes PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.197e-21
Identity = 45/86 (52.33%), Postives = 64/86 (74.42%), Query Frame = 1
Query:   16 AVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAM 273
            AV+NQP++  I+  G  FQ Y+ G+++G CG SL+H +T +GYG +    YWIV+NSWGSSWG+GGY+R+ R+V+ +  G CGIAM
Sbjct:  124 AVSNQPIAALIDASGDNFQYYKGGVYSGPCGFSLNHAITIIGYGRD---SYWIVRNSWGSSWGQGGYVRIRRDVSHS-GGVCGIAM 205          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
XCP1_ARATH2.051e-2762.11Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
CPGP1_ZINOF7.794e-2761.05Zingipain-1 OS=Zingiber officinale PE=1 SV=1[more]
XCP2_ARATH1.330e-2660.00Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]
PAPA2_CARPA2.507e-2557.78Chymopapain OS=Carica papaya PE=1 SV=2[more]
PAPA3_CARPA8.918e-2353.76Caricain OS=Carica papaya PE=1 SV=2[more]
BROM1_ANACO1.165e-2253.26Fruit bromelain OS=Ananas comosus PE=1 SV=1[more]
PAPA4_CARPA1.521e-2252.13Papaya proteinase 4 OS=Carica papaya PE=1 SV=3[more]
CYSP3_HOMAM9.860e-2256.12Digestive cysteine proteinase 3 OS=Homarus america... [more]
ANAN_ANACO9.860e-2251.65Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2[more]
MDO1_PSEMR2.197e-2152.33Macrodontain-1 OS=Pseudananas macrodontes PE=1 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top