DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: BROM2_ANACO (Stem bromelain OS=Ananas comosus PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.638e-18
Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ++  AV+ QP++VA++     FQ Y+SG+F G CGTSL+H VTA+GY    G D  I    WG+ WGE GYIRM R+V+ + +G CGIA++  Y
Sbjct:  120 SMMYAVSKQPITVAVDANAN-FQYYKSGVFNGPCGTSLNHAVTAIGY----GQDSIIYPKKWGAKWGEAGYIRMARDVSSS-SGICGIAIDPLY 207          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: MEX2_JACME (Chymomexicain OS=Jacaratia mexicana PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.513e-17
Identity = 45/88 (51.14%), Postives = 56/88 (63.64%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGI 267
            +L + + NQPVSV  E  G AFQLY+ GIF G CG   DH VTA+GYG     D    KNSWG +WGE GYI+++R  +G   G CG+
Sbjct:  121 SLIQGIGNQPVSVLHESKGRAFQLYKGGIFNGPCGYKNDHAVTAIGYGKAQLLD----KNSWGPNWGEKGYIKIKR-ASGKSEGTCGV 203          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_CANFA (Cathepsin L1 OS=Canis familiaris GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.599e-17
Identity = 51/101 (50.50%), Postives = 62/101 (61.39%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGI-FTGRCGTS-LDHGVTAVGYG---TEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +FQ Y+SGI F   C +  LDHGV  VGYG   T+    +WIVKNSWG  WG  GY++M ++        CGIA  ASY
Sbjct:  234 KALMKAVATLGPISVAIDAGHQSFQFYKSGIYFDPDCSSKDLDHGVLVVGYGFEGTDSNNKFWIVKNSWGPEWGWNGYVKMAKD----QNNHCGIATAASY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: P34_SOYBN (P34 probable thiol protease OS=Glycine max PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.312e-17
Identity = 47/98 (47.96%), Postives = 59/98 (60.20%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +A   A+  QP+SV+I+     F LY  GI+ G   TS   ++H V  VGYG+  G DYWI KNSWG  WGE GYI ++RN  G L G CG+   ASY
Sbjct:  260 QAFLSAILEQPISVSIDAKD--FHLYTGGIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGFDWGEDGYIWIQRN-TGNLLGVCGMNYFASY 354          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATS_BOVIN (Cathepsin S OS=Bos taurus GN=CTSS PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 7.312e-17
Identity = 47/97 (48.45%), Postives = 63/97 (64.95%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTG-RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +AL++AVAN+ PVSV I+    +F LY++G++    C  +++HGV  VGYG   G DYW+VKNSWG  +G+ GYIRM RN        CGIA   SY
Sbjct:  236 EALKEAVANKGPVSVGIDASHSSFFLYKTGVYYDPSCTQNVNHGVLVVGYGNLDGKDYWLVKNSWGLHFGDQGYIRMARNSG----NHCGIANYPSY 328          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL_DROME (Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 7.312e-17
Identity = 48/99 (48.48%), Postives = 65/99 (65.66%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTG-RCGT-SLDHGVTAVGYGT-EXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            K + +AVA   PVSVAI+    +FQ Y  G++   +C   +LDHGV  VG+GT E G DYW+VKNSWG++WG+ G+I+M RN       +CGIA  +SY
Sbjct:  274 KKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRN----KENQCGIASASSY 368          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATS_MOUSE (Cathepsin S OS=Mus musculus GN=Ctss PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.550e-17
Identity = 47/96 (48.96%), Postives = 62/96 (64.58%), Query Frame = 1
Query:    4 ALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTG-RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL++AVA + PVSV I+    +F  Y+SG++    C  +++HGV  VGYGT  G DYW+VKNSWG ++G+ GYIRM RN        CGIA   SY
Sbjct:  246 ALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARN----NKNHCGIASYCSY 337          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL2_HUMAN (Cathepsin L2 OS=Homo sapiens GN=CTSL2 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.247e-16
Identity = 50/102 (49.02%), Postives = 62/102 (60.78%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGI-FTGRCGT-SLDHGVTAVGYGTEXG----ADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVA++ G  +FQ Y+SGI F   C + +LDHGV  VGYG E      + YW+VKNSWG  WG  GY++    +A      CGIA  ASY
Sbjct:  234 KALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVK----IAKDKNNHCGIATAASY 331          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_SHEEP (Cathepsin L1 OS=Ovis aries GN=CTSL PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.128e-16
Identity = 50/99 (50.51%), Postives = 62/99 (62.63%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGAD-YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +FQ Y+SGI+     +S  LDHGV  VGYG E   + +WIVKNSWG  WG  GY++M ++        CGIA  ASY
Sbjct:  120 KALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTNNKFWIVKNSWGPEWGNKGYVKMAKD----QNNHCGIATAASY 214          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_CERAE (Cathepsin L1 OS=Cercopithecus aethiops GN=CTSL1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.128e-16
Identity = 50/102 (49.02%), Postives = 61/102 (59.80%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGI-FTGRCGTS-LDHGVTAVGYGTEX----GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +F  Y+ GI F   C +  +DHGV  VGYG E      + YW+VKNSWG  WG GGYI+M ++        CGIA  ASY
Sbjct:  233 KALMKAVATVGPISVAIDAGHESFMFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNSKYWLVKNSWGEEWGMGGYIKMAKD----RRNHCGIASAASY 330          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
BROM2_ANACO8.638e-1847.87Stem bromelain OS=Ananas comosus PE=1 SV=1[more]
MEX2_JACME2.513e-1751.14Chymomexicain OS=Jacaratia mexicana PE=1 SV=1[more]
CATL1_CANFA5.599e-1750.50Cathepsin L1 OS=Canis familiaris GN=CTSL1 PE=2 SV=... [more]
P34_SOYBN7.312e-1747.96P34 probable thiol protease OS=Glycine max PE=1 SV... [more]
CATS_BOVIN7.312e-1748.45Cathepsin S OS=Bos taurus GN=CTSS PE=1 SV=2[more]
CATL_DROME7.312e-1748.48Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1... [more]
CATS_MOUSE9.550e-1748.96Cathepsin S OS=Mus musculus GN=Ctss PE=2 SV=1[more]
CATL2_HUMAN1.247e-1649.02Cathepsin L2 OS=Homo sapiens GN=CTSL2 PE=1 SV=2[more]
CATL1_SHEEP2.128e-1650.51Cathepsin L1 OS=Ovis aries GN=CTSL PE=1 SV=1[more]
CATL1_CERAE2.128e-1649.02Cathepsin L1 OS=Cercopithecus aethiops GN=CTSL1 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top