DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP5_DICDI (Cysteine proteinase 5 OS=Dictyostelium discoideum GN=cprE PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 2.779e-16
Identity = 52/115 (45.22%), Postives = 64/115 (55.65%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIF-TGRCGT-SLDHGVTAVGYGTEXGA-------------------DYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +L+ AV   PVSVAI+    +FQLY SGI+    C + +LDHGV AVGYG+  G+                   +YWIVKNSWG+SWG  GYI M RN        CGIA  AS+
Sbjct:  231 SLESAVNVNPVSVAIDASHQSFQLYTSGIYYEPECSSENLDHGVLAVGYGSGSGSSSGQSSGQSSGNLSASSSNEYWIVKNSWGTSWGIEGYILMSRN----RDNNCGIASSASF 341          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATS_SAIBB (Cathepsin S OS=Saimiri boliviensis boliviensis GN=CTSS PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.779e-16
Identity = 45/95 (47.37%), Postives = 60/95 (63.16%), Query Frame = 1
Query:    7 LQKAVANQ-PVSVAIEGGGMAFQLYESGIFTG-RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            L++AVAN+ PV V ++    +F LY SG++    C   ++HGV  +GYG   G +YW+VKNSWGS++GE GYIRM RN        CGIA   SY
Sbjct:  237 LKEAVANKGPVCVGVDASHPSFFLYRSGVYYDPACTQKVNHGVLVIGYGDLNGKEYWLVKNSWGSNFGEQGYIRMARNKG----NHCGIASYPSY 327          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL2_BOVIN (Cathepsin L2 OS=Bos taurus GN=CTSL2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.779e-16
Identity = 52/103 (50.49%), Postives = 63/103 (61.17%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGAD-----YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +FQ Y+SGI+     +S  LDHGV  VGYG E G D     +WIVKNSWG  WG  GY++M ++        CGIA  ASY
Sbjct:  234 KALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFE-GTDSNNNKFWIVKNSWGPEWGWNGYVKMAKD----QNNHCGIATAASY 331          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_BOVIN (Cathepsin L1 OS=Bos taurus GN=CTSL1 PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 2.779e-16
Identity = 52/103 (50.49%), Postives = 63/103 (61.17%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGAD-----YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +FQ Y+SGI+     +S  LDHGV  VGYG E G D     +WIVKNSWG  WG  GY++M ++        CGIA  ASY
Sbjct:  234 KALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFE-GTDSNNNKFWIVKNSWGPEWGWNGYVKMAKD----QNNHCGIATAASY 331          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATS_RAT (Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.629e-16
Identity = 48/98 (48.98%), Postives = 63/98 (64.29%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGG-MAFQLYESGIFTG-RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +AL++AVA + PVSV I+     +F LY+SG++    C  +++HGV  VGYGT  G DYW+VKNSWG  +G+ GYIRM RN        CGIA   SY
Sbjct:  234 EALKEAVATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYGTLDGKDYWLVKNSWGLHFGDQGYIRMARN----NKNHCGIASYCSY 327          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATS_HUMAN (Cathepsin S OS=Homo sapiens GN=CTSS PE=1 SV=3)

HSP 1 Score: 85.8853 bits (211), Expect = 3.629e-16
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 1
Query:    7 LQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            L++AVAN+ PVSV ++    +F LY SG++    C  +++HGV  VGYG   G +YW+VKNSWG ++GE GYIRM RN        CGIA   SY
Sbjct:  238 LKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKG----NHCGIASFPSY 328          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_CHICK (Cathepsin K OS=Gallus gallus GN=CTSK PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.629e-16
Identity = 45/98 (45.92%), Postives = 62/98 (63.27%), Query Frame = 1
Query:    1 KALQKAVAN-QPVSVAIEGGGMAFQLYESGIF--TGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSV I+    +FQ Y  G++  TG    +++H V AVGYG + G  +WI+KNSWG+ WG  GY+ + RN+  T    CGIA  AS+
Sbjct:  238 KALKRAVARIGPVSVGIDASLPSFQFYSRGVYYDTGCNPENINHAVLAVGYGAQKGTKHWIIKNSWGTEWGNKGYVLLARNMKQT----CGIANLASF 331          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_PIG (Cathepsin L1 OS=Sus scrofa GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.190e-16
Identity = 49/102 (48.04%), Postives = 62/102 (60.78%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEX----GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +FQ Y+SGI+     +S  LDHGV  VGYG E      + +WIVKNSWG  WG  GY++M ++        CGI+  ASY
Sbjct:  234 KALMKAVATVGPISVAIDAGHSSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNSSKFWIVKNSWGPEWGWNGYVKMAKD----QNNHCGISTAASY 331          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_PIG (Cathepsin K OS=Sus scrofa GN=CTSK PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.190e-16
Identity = 47/98 (47.96%), Postives = 61/98 (62.24%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CGT-SLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSVAI+    +FQ Y  G++    C + +L+H V AVGYG + G  +WI+KNSWG +WG  GYI M RN        CGIA  AS+
Sbjct:  234 KALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGKKHWIIKNSWGENWGNKGYILMARN----KNNACGIANLASF 327          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_RABIT (Cathepsin K OS=Oryctolagus cuniculus GN=CTSK PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.085e-16
Identity = 47/98 (47.96%), Postives = 61/98 (62.24%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CGT-SLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSVAI+    +FQ Y  G++    C + +++H V AVGYG + G  +WI+KNSWG SWG  GYI M RN        CGIA  AS+
Sbjct:  233 KALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARN----KNNACGIANLASF 326          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
CYSP5_DICDI2.779e-1645.22Cysteine proteinase 5 OS=Dictyostelium discoideum ... [more]
CATS_SAIBB2.779e-1647.37Cathepsin S OS=Saimiri boliviensis boliviensis GN=... [more]
CATL2_BOVIN2.779e-1650.49Cathepsin L2 OS=Bos taurus GN=CTSL2 PE=2 SV=1[more]
CATL1_BOVIN2.779e-1650.49Cathepsin L1 OS=Bos taurus GN=CTSL1 PE=1 SV=3[more]
CATS_RAT3.629e-1648.98Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1[more]
CATS_HUMAN3.629e-1648.42Cathepsin S OS=Homo sapiens GN=CTSS PE=1 SV=3[more]
CATK_CHICK3.629e-1645.92Cathepsin K OS=Gallus gallus GN=CTSK PE=2 SV=1[more]
CATL1_PIG6.190e-1648.04Cathepsin L1 OS=Sus scrofa GN=CTSL1 PE=2 SV=1[more]
CATK_PIG6.190e-1647.96Cathepsin K OS=Sus scrofa GN=CTSK PE=2 SV=1[more]
CATK_RABIT8.085e-1647.96Cathepsin K OS=Oryctolagus cuniculus GN=CTSK PE=1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top