DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_MACMU (Cathepsin K OS=Macaca mulatta GN=CTSK PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.085e-16
Identity = 47/98 (47.96%), Postives = 59/98 (60.20%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSVAI+    +FQ Y  G++      S  L+H V AVGYG + G  +WI+KNSWG +WG  GYI M RN        CGIA  AS+
Sbjct:  233 KALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARN----KNNACGIANLASF 326          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_MACFA (Cathepsin K OS=Macaca fascicularis GN=CTSK PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.085e-16
Identity = 47/98 (47.96%), Postives = 59/98 (60.20%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSVAI+    +FQ Y  G++      S  L+H V AVGYG + G  +WI+KNSWG +WG  GYI M RN        CGIA  AS+
Sbjct:  233 KALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARN----KNNACGIANLASF 326          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_HUMAN (Cathepsin K OS=Homo sapiens GN=CTSK PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.085e-16
Identity = 47/98 (47.96%), Postives = 59/98 (60.20%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGRCGTS--LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSVAI+    +FQ Y  G++      S  L+H V AVGYG + G  +WI+KNSWG +WG  GYI M RN        CGIA  AS+
Sbjct:  233 KALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARN----KNNACGIANLASF 326          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CRUST_PANBO (Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.056e-15
Identity = 49/98 (50.00%), Postives = 60/98 (61.22%), Query Frame = 1
Query:    4 ALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCGT-SLDHGVTAVGYGTEX-GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            ALQ AV N+ PVSV I+ G  +F  Y  G++    C +   +H VTAVGYGT+  G DYWIVKNSWG+ WGE GYI+M RN        C IA  + Y
Sbjct:  227 ALQHAVQNEGPVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAVTAVGYGTDANGGDYWIVKNSWGAWWGESGYIKMARN----RDNNCAIATYSVY 320          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_HUMAN (Cathepsin L1 OS=Homo sapiens GN=CTSL1 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.056e-15
Identity = 49/102 (48.04%), Postives = 60/102 (58.82%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGI-FTGRCGTS-LDHGVTAVGYGTEXGAD----YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVAI+ G  +F  Y+ GI F   C +  +DHGV  VGYG E        YW+VKNSWG  WG GGY++M ++        CGIA  ASY
Sbjct:  233 KALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKD----RRNHCGIASAASY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_CANFA (Cathepsin K OS=Canis familiaris GN=CTSK PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.056e-15
Identity = 46/98 (46.94%), Postives = 61/98 (62.24%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CGT-SLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   P+SVAI+    +FQ Y  G++    C + +L+H V AVGYG + G  +WI+KNSWG +WG  GYI M RN        CGIA  AS+
Sbjct:  234 KALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARN----KNNACGIANLASF 327          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_BOVIN (Cathepsin K OS=Bos taurus GN=CTSK PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.056e-15
Identity = 46/98 (46.94%), Postives = 61/98 (62.24%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CGT-SLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   P+SVAI+    +FQ Y  G++    C + +L+H V AVGYG + G  +WI+KNSWG +WG  GYI M RN        CGIA  AS+
Sbjct:  233 KALKRAVARVGPISVAIDASLTSFQFYRKGVYYDENCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARN----KNNACGIANLASF 326          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ORYC_ORYSJ (Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 1.379e-15
Identity = 43/90 (47.78%), Postives = 57/90 (63.33%), Query Frame = 1
Query:   28 QPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +PVSVA +     F++Y+SG++T   CGTS   ++H V AVGYG E G  YW++KNSWG+ WG+ GY +ME          CGIA  ASY
Sbjct:  275 RPVSVAFQVIN-GFRMYKSGVYTSDHCGTSPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMG-----KNMCGIATCASY 358          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL_BRUPA (Cathepsin L-like OS=Brugia pahangi PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.801e-15
Identity = 47/97 (48.45%), Postives = 59/97 (60.82%), Query Frame = 1
Query:    4 ALQKAVANQ-PVSVAIEGGGMAFQLYESGIFT-GRCGTSLDHGVTAVGYGTEXG-ADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            AL+ AVA + PV V I G   +F+ Y+ G+++ G CG   DH V AVGYGT     DYWIVKNSWG+ WG+ GY+ M RN        C IA  AS+
Sbjct:  302 ALKHAVAKRGPVVVGISGSKRSFRFYKDGVYSEGNCGRP-DHAVLAVGYGTHPSYGDYWIVKNSWGTDWGKDGYVYMARNRG----NMCHIASAASF 393          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATLL_FASHE (Cathepsin L-like proteinase OS=Fasciola hepatica GN=Cat-1 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.801e-15
Identity = 45/89 (50.56%), Postives = 56/89 (62.92%), Query Frame = 1
Query:   22 ANQPVSVAIEGGGMAFQLYESGIFTGRCGTSL--DHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEAS 282
            A +P +VA++     F +Y SGI+  +  + L  +H V AVGYGT+ G DYWIVKNSWG+ WGE GYIRM RN        CGIA  AS
Sbjct:  235 ARRPAAVAVDVES-DFMMYRSGIYQSQTCSPLRVNHAVLAVGYGTQGGTDYWIVKNSWGTYWGERGYIRMARNRG----NMCGIASLAS 318          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
CATK_MACMU8.085e-1647.96Cathepsin K OS=Macaca mulatta GN=CTSK PE=1 SV=1[more]
CATK_MACFA8.085e-1647.96Cathepsin K OS=Macaca fascicularis GN=CTSK PE=2 SV... [more]
CATK_HUMAN8.085e-1647.96Cathepsin K OS=Homo sapiens GN=CTSK PE=1 SV=1[more]
CRUST_PANBO1.056e-1550.00Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1[more]
CATL1_HUMAN1.056e-1548.04Cathepsin L1 OS=Homo sapiens GN=CTSL1 PE=1 SV=2[more]
CATK_CANFA1.056e-1546.94Cathepsin K OS=Canis familiaris GN=CTSK PE=2 SV=1[more]
CATK_BOVIN1.056e-1546.94Cathepsin K OS=Bos taurus GN=CTSK PE=2 SV=2[more]
ORYC_ORYSJ1.379e-1547.78Oryzain gamma chain OS=Oryza sativa subsp. japonic... [more]
CATL_BRUPA1.801e-1548.45Cathepsin L-like OS=Brugia pahangi PE=1 SV=1[more]
CATLL_FASHE1.801e-1550.56Cathepsin L-like proteinase OS=Fasciola hepatica G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top