DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP2_MAIZE (Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.352e-15
Identity = 43/90 (47.78%), Postives = 57/90 (63.33%), Query Frame = 1
Query:   28 QPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +PVSVA E     F+LY+SG++T   CGT+   ++H V AVGYG E G  YW++KNSWG+ WG+ GY +ME          CG+A  ASY
Sbjct:  273 RPVSVAFEVI-TGFRLYKSGVYTSDHCGTTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDEGYFKMEMG-----KNMCGVATCASY 356          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_RAT (Cathepsin K OS=Rattus norvegicus GN=Ctsk PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.844e-15
Identity = 44/98 (44.90%), Postives = 59/98 (60.20%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CGT-SLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   PVSV+I+    +FQ Y  G++    C   +++H V  VGYGT+ G  YWI+KNSWG SWG  GY+ + RN        CGI   AS+
Sbjct:  233 KALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARN----KNNACGITNLASF 326          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 6.844e-15
Identity = 42/90 (46.67%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   28 QPVSVAIEGGGMAFQLYESGIFT-GRCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +PVS+A E    +F+LY+SG++T   CG++   ++H V AVGYG E G  YW++KNSWG+ WG+ GY +ME          CGIA  ASY
Sbjct:  271 RPVSIAFEVIH-SFRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMG-----KNMCGIATCASY 354          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_MOUSE (Cathepsin L1 OS=Mus musculus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.167e-14
Identity = 50/103 (48.54%), Postives = 61/103 (59.22%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCGT-SLDHGVTAVGYGTEXGAD-----YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVA++    + Q Y SGI+    C + +LDHGV  VGYG E G D     YW+VKNSWGS WG  GYI+    +A      CG+A  ASY
Sbjct:  233 KALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYE-GTDSNKNKYWLVKNSWGSEWGMEGYIK----IAKDRDNHCGLATAASY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATL1_RAT (Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.991e-14
Identity = 49/103 (47.57%), Postives = 59/103 (57.28%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCGTS-LDHGVTAVGYGTEXGAD-----YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL KAVA   P+SVA++    + Q Y SGI+    C +  LDHGV  VGYG E G D     YW+VKNSWG  WG  GYI+    +A      CG+A  ASY
Sbjct:  233 KALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYE-GTDSNKDKYWLVKNSWGKEWGMDGYIK----IAKDRNNHCGLATAASY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATK_MOUSE (Cathepsin K OS=Mus musculus GN=Ctsk PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 3.397e-14
Identity = 42/98 (42.86%), Postives = 59/98 (60.20%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIFTGR-CGT-SLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            KAL++AVA   P+SV+I+    +FQ Y  G++    C   +++H V  VGYGT+ G+ +WI+KNSWG SWG  GY  + RN        CGI   AS+
Sbjct:  233 KALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARN----KNNACGITNMASF 326          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ALEU_HORVU (Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.397e-14
Identity = 44/93 (47.31%), Postives = 56/93 (60.22%), Query Frame = 1
Query:   28 QPVSVA---IEGGGMAFQLYESGIFTG-RCGTSLD---HGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +PVSVA   I+G    F+ Y+SG++T   CGT+ D   H V AVGYG E G  YW++KNSWG+ WG+ GY +ME          C IA  ASY
Sbjct:  274 RPVSVAFQVIDG----FRQYKSGVYTSDHCGTTPDDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMG-----KNMCAIATCASY 357          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP_THEAN (Cysteine proteinase OS=Theileria annulata GN=TACP PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 4.436e-14
Identity = 36/68 (52.94%), Postives = 44/68 (64.71%), Query Frame = 1
Query:   70 QLYESGIFTGRCGTSLDHGVTAVGYGT--EXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGI 267
            +LY  GIFTG+CG  L+H V  VG G   E G  YWI+KNSWG  WGE G++R++R   G    KCGI
Sbjct:  364 KLYSGGIFTGKCGGELNHAVLLVGEGVDHETGMRYWIIKNSWGEDWGENGFLRLQRTKKG--LDKCGI 429          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP3_SOLLC (Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.794e-14
Identity = 41/90 (45.56%), Postives = 54/90 (60.00%), Query Frame = 1
Query:   28 QPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +PVSVA E     F+ Y+SG++    CG +   ++H V AVGYG E G  YW++KNSWG+ WGE GY +ME          CG+A  ASY
Sbjct:  269 RPVSVAFEVV-KGFKQYKSGVYASTECGDTPMDVNHAVLAVGYGVENGTPYWLIKNSWGADWGEDGYFKMEMG-----KNMCGVATCASY 352          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP_THEPA (Cysteine proteinase OS=Theileria parva GN=TP03_0285 PE=3 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 7.567e-14
Identity = 35/66 (53.03%), Postives = 45/66 (68.18%), Query Frame = 1
Query:   76 YESGIFTGRCGTSLDHGVTAVGYGTEXGAD--YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGI 267
            Y+SG+FTG CG SL+H V  VG G +      YW+V+NSWG+ WGE GY+R+ER   G  T KCG+
Sbjct:  367 YKSGVFTGECGKSLNHAVVLVGEGYDEVTKKRYWVVQNSWGTDWGENGYMRLERTNMG--TDKCGV 430          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
CYSP2_MAIZE2.352e-1547.78Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=... [more]
CATK_RAT6.844e-1544.90Cathepsin K OS=Rattus norvegicus GN=Ctsk PE=2 SV=1[more]
ALEU_ARATH6.844e-1546.67Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]
CATL1_MOUSE1.167e-1448.54Cathepsin L1 OS=Mus musculus GN=Ctsl1 PE=1 SV=2[more]
CATL1_RAT1.991e-1447.57Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV... [more]
CATK_MOUSE3.397e-1442.86Cathepsin K OS=Mus musculus GN=Ctsk PE=2 SV=2[more]
ALEU_HORVU3.397e-1447.31Thiol protease aleurain OS=Hordeum vulgare PE=2 SV... [more]
CYSP_THEAN4.436e-1452.94Cysteine proteinase OS=Theileria annulata GN=TACP ... [more]
CYSP3_SOLLC5.794e-1445.56Cysteine proteinase 3 OS=Solanum lycopersicum GN=C... [more]
CYSP_THEPA7.567e-1453.03Cysteine proteinase OS=Theileria parva GN=TP03_028... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top