DC900057

Overview
NameDC900057
Unique NameDC900057
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length931
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:359..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: LMCPB_LEIME (Cysteine proteinase B OS=Leishmania mexicana GN=LMCPB PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 4.152e-12
Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query:   25 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTL 249
            N P+++A++    +F  Y+SG+ T   G  L+HGV  VGY       YW++KNSWG  WGE GY+R+   V   L
Sbjct:  258 NGPIAIALDAS--SFMSYKSGVLTACIGKQLNHGVLLVGYDMTGEVPYWVIKNSWGGDWGEQGYVRVVMGVNACL 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP2_LEIPI (Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS2 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.152e-12
Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query:   25 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTL 249
            N P+++A++    +F  Y+SG+ T   G  L+HGV  VGY       YW++KNSWG  WGE GY+R+   V   L
Sbjct:  259 NGPIAIALDAS--SFMSYKSGVLTACIGKQLNHGVLLVGYDMTGEVPYWVIKNSWGGDWGEQGYVRVVMGVNACL 331          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATV_NPVST (Viral cathepsin OS=Spodoptera litura multicapsid nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.152e-12
Identity = 40/92 (43.48%), Postives = 49/92 (53.26%), Query Frame = 1
Query:    1 KALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAME 276
            K L+    N P++VAI+   +    Y SGI T      L+H V  VGYG E    YWI KNSWGS+WGE GY R  RN+       CG+  E
Sbjct:  245 KLLELLYKNGPIAVAIDCVDIID--YRSGIATVCNDNGLNHAVLLVGYGIENDTPYWIFKNSWGSNWGENGYFRARRNI-----NACGMLNE 329          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATV_NPVAH (Viral cathepsin OS=Adoxophyes honmai nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.152e-12
Identity = 32/69 (46.38%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   31 PVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNV 237
            P+++AI+   ++   Y  GI        L+H V  VGYGTE G  YW +KNSWGS WGE GY R++RN+
Sbjct:  255 PIAMAIDAASIS--TYSKGIIHFCENLGLNHAVLLVGYGTEGGVSYWTLKNSWGSDWGEDGYFRVKRNI 321          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: ACP2_ENTHI (Cysteine proteinase ACP2 (Fragment) OS=Entamoeba histolytica GN=ACP2 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.152e-12
Identity = 39/88 (44.32%), Postives = 54/88 (61.36%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRM--ERNVAGTLT 252
            L+ A++   + V+I+     FQLY+SG +T  +C  +   L+H V AVGYG   G + WIV+NSWG+SWG+ GYI M  E N  G  T
Sbjct:  212 LKAALSQGLLDVSIDVSSAKFQLYKSGAYTDTKCKNNYFALNHEVCAVGYGVVDGKECWIVRNSWGTSWGDKGYINMVIEGNTCGVAT 299          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: TEST2_RAT (Testin-2 OS=Rattus norvegicus GN=Testin PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 5.423e-12
Identity = 42/102 (41.18%), Postives = 60/102 (58.82%), Query Frame = 1
Query:    1 KALQKAVANQ-PVSVAIEGGGMAFQLYESGIF-TGRCG-TSLDHGVTAVGYGTEX----GADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +AL KAVA   P+SVA++    +FQ Y SGI+   +C    L+H V  VGYG E     G  +W+VKNSWG  WG  GY+++ ++     +  CGIA  ++Y
Sbjct:  233 EALMKAVAKVGPISVAVDASHGSFQFYGSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSFWLVKNSWGEEWGMKGYMKLAKD----WSNHCGIATYSTY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.423e-12
Identity = 48/133 (36.09%), Postives = 60/133 (45.11%), Query Frame = 1
Query:    4 ALQKAVANQPVSVAIEGGGMAFQLYESGIF-TGRCG-TSLDHGVTAVGYGTEXGAD-------------------------------------YWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +L+    + PVSVAI+    +FQLY SGI+   +C  T LDHGV  VGYG +   D                                     YWIVKNSWG+SWG  GYI M ++        CGIA  +SY
Sbjct:  245 SLENGAQHGPVSVAIDASHNSFQLYTSGIYYEPKCSPTELDHGVLVVGYGVQGKDDEGPVLNRKQTIVIHKNEDNKVESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKD----RKNNCGIASVSSY 373          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CPP3_ENTHI (Cysteine proteinase 3 (Fragment) OS=Entamoeba histolytica GN=CPNP PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 7.083e-12
Identity = 38/88 (43.18%), Postives = 53/88 (60.23%), Query Frame = 1
Query:    7 LQKAVANQPVSVAIEGGGMAFQLYESGIFTG-RCGTS---LDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRM--ERNVAGTLT 252
            L+ A++   V V+I+     FQLY+SG ++  +C  +   L+H V AVGYG   G + WIV+NSWG+ WG+ GYI M  E N  G  T
Sbjct:  210 LKAALSQGLVDVSIDASSAKFQLYKSGAYSDTKCKNNFFALNHEVCAVGYGVVDGKECWIVRNSWGTGWGDKGYINMVIEGNTCGVAT 297          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATH_PIG (Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.208e-11
Identity = 43/100 (43.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:    1 KALQKAVA-NQPVSVAIEGGGMAFQLYESGIFTG----RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +A+ +AVA   PVS A E     F +Y  GI++     +    ++H V AVGYG E G  YWIVKNSWG  WG  GY  +ER         CG+A  ASY
Sbjct:  237 EAMVEAVALYNPVSFAFEVTN-DFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERG-----KNMCGLAACASY 330          
BLAST of DC900057 vs. ExPASy Swiss-Prot
Match: CATH_BOVIN (Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.208e-11
Identity = 42/100 (42.00%), Postives = 56/100 (56.00%), Query Frame = 1
Query:    1 KALQKAVA-NQPVSVAIEGGGMAFQLYESGIFTG----RCGTSLDHGVTAVGYGTEXGADYWIVKNSWGSSWGEGGYIRMERNVAGTLTGKCGIAMEASY 285
            +A+ +AVA + PVS A E     F +Y  GI++     +    ++H V AVGYG E G  YWIVKNSWG +WG  GY  +ER         CG+A  AS+
Sbjct:  237 EAMVEAVALHNPVSFAFEVTA-DFMMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEEKGIPYWIVKNSWGPNWGMKGYFLIERG-----KNMCGLAACASF 330          
The following BLAST results are available for this feature:
BLAST of DC900057 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
LMCPB_LEIME4.152e-1241.33Cysteine proteinase B OS=Leishmania mexicana GN=LM... [more]
CYSP2_LEIPI4.152e-1241.33Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS... [more]
CATV_NPVST4.152e-1243.48Viral cathepsin OS=Spodoptera litura multicapsid n... [more]
CATV_NPVAH4.152e-1246.38Viral cathepsin OS=Adoxophyes honmai nucleopolyhed... [more]
ACP2_ENTHI4.152e-1244.32Cysteine proteinase ACP2 (Fragment) OS=Entamoeba h... [more]
TEST2_RAT5.423e-1241.18Testin-2 OS=Rattus norvegicus GN=Testin PE=1 SV=2[more]
CYSP2_DICDI5.423e-1236.09Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
CPP3_ENTHI7.083e-1243.18Cysteine proteinase 3 (Fragment) OS=Entamoeba hist... [more]
CATH_PIG1.208e-1143.00Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1[more]
CATH_BOVIN1.208e-1142.00Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900057 VSS Citrus sinensis cDNA clone VS27Q65 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900057 ID=DC900057|Name=DC900057|organism=Citrus sinensis|type=EST|length=931bp
AAAGCTTTGCAAAAGGCAGTTGCAAATCAACCCGTGAGTGTTGCCATTGA
AGGAGGTGGCATGGCATTCCAGTTATATGAATCGGGTATATTTACGGGAA
GATGTGGGACATCTCTGGACCATGGTGTTACTGCTGTTGGATATGGCACA
GAAANTGGAGCTGATTACTGGATTGTGAAGAATTCATGGGGCAGTAGCTG
GGGAGAGGGTGGCTATATTAGGATGGAGCGTAACGTGGCTGGCACTCTCA
CGGGCAAGTGTGGAATTGCCATGGAGGCCTCATATCCCATAAAGAAAGGC
CAAAATCCTCCCAACCCCGGACCGTCTCCTCCATCTCCAACAAAGCCTCC
TGCTGTGTGTGACAATTATTACTCTTGCCCTGAGAGCAACACTTGCTGCT
GTGTCTTTGAGTATGGTAACTCTTGCTTTGCATGGGGATGCTGCCCGCTT
GAGGCTGCCACCTGCTGTGATGACCACTATAGCTGCTGCCCACATGACTA
TCCCATCTGTAATGTTCGTGCTGGGACCTGCTTGATGAGCAAGGACAACC
CATTGGGAGTGAGGGCATTGCGACGCACCCCTGCTAAACCTTACTGGGCT
CATGGAAATCAAGGTGGAAGTAGCAGTGCTTAATTATAGTTGGCACTGTA
AGAGCAGTGGAAGGCCGAAGGGAGGATGAAGATATTCGTGCTTGTGAATG
AGTTTCTCCCCGGCCTTAGTTCATTTTACTGCATTTCATTTCAAACGTTA
ATGTANCGGCAGGTGGATGGTCTGTTAAATATTTATTCGGACGTTGGTTT
TGTATATAGCGTTGTAAGTTATCTATCTGCGTTGAATCCGAACAATGCAC
AAACAAATTGTTGTTATCTATTTCCAATGTCCTCCACCAAATCCCTGGCA
TCATTCAGCGGAGGCTTTTATGAATTGATAT
back to top