DC900049

Overview
NameDC900049
Unique NameDC900049
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:637..1258. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX13_HUMAN (Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 4.021e-16
Identity = 51/124 (41.13%), Postives = 71/124 (57.26%), Query Frame = -3
Query:  222 ILATRSKAQINATLNQYKNVYGNDIDQDLE----ADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALL 581
            +LA RS  Q+ AT   Y+ + G DI++ +E     D +  YL L+R    C    E YF + L  ++   GTDE  L R+V TRAEVDL+ IK ++Q +    L   V  DTSGD+ K+L+ALL
Sbjct:  196 VLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDC----EDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA5_CHICK (Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 5.252e-16
Identity = 44/132 (33.33%), Postives = 75/132 (56.82%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++E  I IL TRS + +    ++Y  + G  I++ ++ +   +   LL A V+C+     YF + L  ++   GTD+  L RV+ +R+E+DL  I+ E+++  +  L + + KDTSGDY K LL L G  D
Sbjct:  189 TDEETFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGDLEKLLLAVVKCIRSVPAYFAETLYYSMKGAGTDDDTLIRVMVSRSEIDLLDIRHEFRKNFAKSLYQMIQKDTSGDYRKALLLLCGGDD 320          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA3_HUMAN (Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 1.170e-15
Identity = 47/136 (34.56%), Postives = 72/136 (52.94%), Query Frame = -3
Query:  210 NKTSNDED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            N+   DED    IL  RS  Q+  T ++Y+N+   DI   ++ +    + DLL A V C+     +  + L  A+   GTDE  L R++ +R+E+DL  I+ E+++     L  A+  DTSGDYE  LL + G  D
Sbjct:  188 NRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD 323          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA3_RAT (Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4)

HSP 1 Score: 82.8037 bits (203), Expect = 1.528e-15
Identity = 46/135 (34.07%), Postives = 71/135 (52.59%), Query Frame = -3
Query:  210 KTSNDED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 611
            K   DED    IL  RS  Q+  T ++Y+N+   DI+  ++ +    + DLL A V+C      +    L  A+   GTDE  L R++ +R+E+DL  I+ E+++     L  A+  DTSGDY  +LL + G  D
Sbjct:  190 KWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIEDSIKGELSGHFEDLLLAVVRCTRNTPAFLAGRLHQALKGAGTDEFTLNRIMVSRSEIDLLDIRREFKKHYGCSLYSAIQSDTSGDYRTVLLKICGGDD 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA3_BOVIN (Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 1.996e-15
Identity = 46/131 (35.11%), Postives = 72/131 (54.96%), Query Frame = -3
Query:  210 DEDLI-RILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 599
            DED    IL  RS  Q+  T ++Y+N+   DI+  ++ +    + DLL A V+C      +  + L  A+   GTDE  L R++ +R+E+DL  I+ E+++ +   L  A+  DTSGDYE  LL + G  D
Sbjct:  193 DEDAFTNILCLRSFPQLKLTFDEYRNISQKDIEDSIKGELSGHFEDLLLAIVRCARNTPAFLAERLYRALKGAGTDEFTLNRIMVSRSEIDLLDIRAEFKKLSGYSLYSAIKSDTSGDYEITLLKICGGDD 323          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX13_CANFA (Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 3.404e-15
Identity = 45/120 (37.50%), Postives = 67/120 (55.83%), Query Frame = -3
Query:  222 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALL 581
            +LA RS  Q+ AT   Y+ +   DI++ +EA+   +        V+C    E YF   L  ++   GTDE  L  ++ TRAEVDL+ IK ++Q +    L   V  DTSGD++K+L+ALL
Sbjct:  196 VLAKRSHKQLRATFQAYQILIDKDIEEAIEAETSGDLQKAYLTLVRCARDQEGYFADRLYKSMKGTGTDEETLIHIIVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFQKLLVALL 315          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX11_BOVIN (Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.905e-15
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = -3
Query:  210 NKTSNDEDLIR-ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            N+   DE     IL +RS+A + A  N+Y+ + G DI++ +  +   +    + A V+CL     +F + L  A+   GT +  L R++ +R+E+DL  I+ EY+R     L   +  DTSGDY K+LL + G  D
Sbjct:  368 NRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSEIDLLDIRAEYKRLYGKSLYHDITGDTSGDYRKILLKICGGND 503          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA4_CANFA (Annexin A4 OS=Canis familiaris GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.294e-14
Identity = 40/132 (30.30%), Postives = 74/132 (56.06%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   + +L +R++  +    ++YK +   DI+Q ++++    + D L A V+C+     YF + L  ++   GTD+  L RV+ +RAE+D+  I++ ++R     L   +  DTSGDY K+LL L G  D
Sbjct:  188 TDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQGIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMMDIRESFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD 319          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_CAVCU (Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.294e-14
Identity = 42/123 (34.15%), Postives = 71/123 (57.72%), Query Frame = -3
Query:  219 IRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 587
            I IL TRS + +     +Y     +D+++ L+ + K +  + L A V+C      +F + L LA+   GT   AL R++ +R+E+D+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  222 ITILTTRSYSHLRRVFQKYTKYSQHDMNKALDLELKGDIENCLTAIVKCATSTPAFFAEKLHLAMKGAGTRHKALIRIMVSRSEIDMNDIKVYYQKMYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX11_MOUSE (Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.294e-14
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = -3
Query:  210 NKTSNDEDLIR-ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            N+   DE     IL +RS+A + A  N+Y+ + G DI++ +  +   +    + A V+CL     +F + L  A+   GT +  L R++ +R+E+DL  I+ EY+R     L   +  DTSGDY K+LL + G  D
Sbjct:  368 NRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLYHDITGDTSGDYRKILLKICGGND 503          
The following BLAST results are available for this feature:
BLAST of DC900049 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
ANX13_HUMAN4.021e-1641.13Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3[more]
ANXA5_CHICK5.252e-1633.33Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2[more]
ANXA3_HUMAN1.170e-1534.56Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3[more]
ANXA3_RAT1.528e-1534.07Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4[more]
ANXA3_BOVIN1.996e-1535.11Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3[more]
ANX13_CANFA3.404e-1537.50Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=... [more]
ANX11_BOVIN9.905e-1533.09Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1[more]
ANXA4_CANFA1.294e-1430.30Annexin A4 OS=Canis familiaris GN=ANXA4 PE=1 SV=2[more]
ANXA1_CAVCU1.294e-1434.15Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1[more]
ANX11_MOUSE1.294e-1433.09Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900049 VSS Citrus sinensis cDNA clone VS27Q55 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900049 ID=DC900049|Name=DC900049|organism=Citrus sinensis|type=EST|length=622bp
AAAGTAGCAGTTTCATANCAAATGCTGTCACCATCTTATTTATAAGATCA
TAGATTAAGTTTTTCAACCGGCATAACCAAAAGACTGAAAATAAAACGAT
CATCACACATGGATAGAGAACACTGCAAACTCCAAGCAACAGCAAACCTA
GATAAATAAAACACATATATTGCCTCTCAATCCTTCAAGAAATAGGGAAC
AACTCAAGCATCCCCATGTCCTAAAAGTGCCAGAAGCATTTTTTCGTAGT
CCCCAGAGGTGTCCTTGACAACGGCGCGATCCAGAGGAACACTGTTCCTC
CTCTGGTACTCATCTTTTATGACCTTCAAGTCGACCTCGGCCCTTGTGGT
GACGACTCTAGTAAGAGCCCCTTCATCTGTTCCCTGTTTGTTAATTGCCA
GACGAAGTATCTTCTCAAAATAATGTTCAGGGCGGACTAAGCACTGAACT
GTGGCCCTCAGTAGGTCGAGGTACTCATCTTTAGGGTCAGCCTCTAAGTC
CTGATCAATATCATTCCCATATACATTCTTGTATTGATTCAGAGTCGCAT
TGATCTGNGCTTTGCTCCTTGTAGCCAAGATCCTGATGAGATCCTCATCA
TTGGAGGTCTTATTCGAAATCT
back to top