DC900049

Overview
NameDC900049
Unique NameDC900049
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:637..1258. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX11_HUMAN (Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.294e-14
Identity = 44/136 (32.35%), Postives = 73/136 (53.68%), Query Frame = -3
Query:  210 NKTSNDEDLIR-ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            N+   DE     +L +RS+A + A  N+Y+ + G DI++ +  +   +  + + A V+CL     +F + L  A+   GT +  L R++ +R+E DL  I+ EY+R     L   +  DTSGDY K+LL + G  D
Sbjct:  370 NRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND 505          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANX11_RABIT (Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.690e-14
Identity = 44/136 (32.35%), Postives = 73/136 (53.68%), Query Frame = -3
Query:  210 NKTSNDEDLIR-ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            N+   DE     +L +RS+A + A  N+Y+ + G DI++ +  +   +    + A V+CL     +F + L  A+   GT +  L R++ +R+E+DL  I+ EY+R     L   +  DTSGDY K+LL + G  D
Sbjct:  368 NRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNRAMRGAGTKDRTLIRIMVSRSEIDLLDIRAEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND 503          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA4_PIG (Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 2.882e-14
Identity = 40/132 (30.30%), Postives = 73/132 (55.30%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   + +L +R++  +    ++YK +   DI+Q ++++    + D L A V+C+     YF + L  ++   GTD+  L RV+ +RAE+D+  I+  ++R     L   +  DTSGDY K+LL L G  D
Sbjct:  188 TDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMMDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD 319          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA4_HUMAN (Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4)

HSP 1 Score: 78.5666 bits (192), Expect = 2.882e-14
Identity = 40/132 (30.30%), Postives = 73/132 (55.30%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   + +L +R++  +    ++YK +   DI+Q ++++    + D L A V+C+     YF + L  ++   GTD+  L RV+ +RAE+D+  I+  ++R     L   +  DTSGDY K+LL L G  D
Sbjct:  188 TDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD 319          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA4_MOUSE (Annexin A4 OS=Mus musculus GN=Anxa4 PE=2 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 3.764e-14
Identity = 41/132 (31.06%), Postives = 73/132 (55.30%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   + IL +R++  +    ++YK +   DI+Q ++++    + D L A V+C+     YF + L  ++   GTD+  L RV+ +RAE+D+  I+  ++R     L   +  DTSGDY K+LL L G  D
Sbjct:  188 TDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD 319          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_RABIT (Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.764e-14
Identity = 44/121 (36.36%), Postives = 68/121 (56.20%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL TRS   +     +Y     +D+++ L+ + K +    L A VQC      YF + L  A+   GT   AL R++ +R+EVD+  IK  YQ++  V L +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTTRSYLHLRRVFQKYSKYSQHDMNKVLDLELKGDIEKCLTAIVQCATCKPAYFAEKLYQAMKGAGTRHKALIRIMVSRSEVDMNDIKAFYQKKYGVSLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA7_BOVIN (Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.916e-14
Identity = 41/121 (33.88%), Postives = 64/121 (52.89%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            ILATRS  Q+ AT+  Y  +   D+   +  +        L+  +QC +    +F + L  ++   GTD+  L R+V TR+E+DL  IK  + +     L   +  DTSGDY K+LLA++G
Sbjct:  342 ILATRSFPQLKATMEAYSRMANRDLLNSVSREFSGNVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFSQMYQKTLGTMIASDTSGDYRKLLLAIVG 462          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA4_BOVIN (Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.916e-14
Identity = 40/132 (30.30%), Postives = 73/132 (55.30%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   + +L +R++  +    ++YK +   DI+Q ++++    + D L A V+C+     YF + L  ++   GTD+  L RV+ +RAE+D+  I+  ++R     L   +  DTSGDY K+LL L G  D
Sbjct:  188 TDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD 319          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA7_MOUSE (Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.385e-14
Identity = 41/121 (33.88%), Postives = 64/121 (52.89%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            ILATRS  Q+ AT+  Y  +   D+   +  +        L+  +QC +    +F + L  ++   GTD+  L R+V TR+E+DL  IK  + +     L   +  DTSGDY K+LLA++G
Sbjct:  342 ILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIVG 462          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA4_RAT (Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 1.095e-13
Identity = 41/132 (31.06%), Postives = 72/132 (54.55%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   + IL +R++  +    ++YK +   DI+Q ++++    + D L A V+C+     YF + L  ++   GTD+  L RV+ +RAE+D+  I   ++R     L   +  DTSGDY K+LL L G  D
Sbjct:  188 TDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKPAYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIPANFKRVYGKSLYSFIKGDTSGDYRKVLLILCGGDD 319          
The following BLAST results are available for this feature:
BLAST of DC900049 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
ANX11_HUMAN1.294e-1432.35Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1[more]
ANX11_RABIT1.690e-1432.35Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=... [more]
ANXA4_PIG2.882e-1430.30Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2[more]
ANXA4_HUMAN2.882e-1430.30Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4[more]
ANXA4_MOUSE3.764e-1431.06Annexin A4 OS=Mus musculus GN=Anxa4 PE=2 SV=3[more]
ANXA1_RABIT3.764e-1436.36Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 ... [more]
ANXA7_BOVIN4.916e-1433.88Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2[more]
ANXA4_BOVIN4.916e-1430.30Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2[more]
ANXA7_MOUSE8.385e-1433.88Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=1[more]
ANXA4_RAT1.095e-1331.06Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900049 VSS Citrus sinensis cDNA clone VS27Q55 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900049 ID=DC900049|Name=DC900049|organism=Citrus sinensis|type=EST|length=622bp
AAAGTAGCAGTTTCATANCAAATGCTGTCACCATCTTATTTATAAGATCA
TAGATTAAGTTTTTCAACCGGCATAACCAAAAGACTGAAAATAAAACGAT
CATCACACATGGATAGAGAACACTGCAAACTCCAAGCAACAGCAAACCTA
GATAAATAAAACACATATATTGCCTCTCAATCCTTCAAGAAATAGGGAAC
AACTCAAGCATCCCCATGTCCTAAAAGTGCCAGAAGCATTTTTTCGTAGT
CCCCAGAGGTGTCCTTGACAACGGCGCGATCCAGAGGAACACTGTTCCTC
CTCTGGTACTCATCTTTTATGACCTTCAAGTCGACCTCGGCCCTTGTGGT
GACGACTCTAGTAAGAGCCCCTTCATCTGTTCCCTGTTTGTTAATTGCCA
GACGAAGTATCTTCTCAAAATAATGTTCAGGGCGGACTAAGCACTGAACT
GTGGCCCTCAGTAGGTCGAGGTACTCATCTTTAGGGTCAGCCTCTAAGTC
CTGATCAATATCATTCCCATATACATTCTTGTATTGATTCAGAGTCGCAT
TGATCTGNGCTTTGCTCCTTGTAGCCAAGATCCTGATGAGATCCTCATCA
TTGGAGGTCTTATTCGAAATCT
back to top