DC900049

Overview
NameDC900049
Unique NameDC900049
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:637..1258. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA8_HUMAN (Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 36/129 (27.91%), Postives = 68/129 (52.71%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK  +++     L   +++DTSGDY+  LL+L+G
Sbjct:  196 TDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVG 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA6_HUMAN (Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3)

HSP 1 Score: 72.0182 bits (175), Expect = 2.697e-12
Identity = 42/135 (31.11%), Postives = 70/135 (51.85%), Query Frame = -3
Query:  210 NKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            +KTS +   + IL TRS   +     ++  +   D++  ++ +   +  D   A VQ +     +F   L  ++   GTDE  LTR++ +R+E+DL  I+ E+  +    L +A+  DTSGD+ K LLAL G  D
Sbjct:  539 DKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED 673          

HSP 2 Score: 69.707 bits (169), Expect = 1.339e-11
Identity = 37/132 (28.03%), Postives = 68/132 (51.52%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   I IL  RSK  +    ++Y    G  I+  +  +   ++  L+ A V+C+     YF + L  A+   GT +  L R++ +R+E+D+  I++ ++ +    L   +  DTSG+Y+K LL L G  D
Sbjct:  194 TDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDD 325          

HSP 3 Score: 68.9366 bits (167), Expect = 2.284e-11
Identity = 42/130 (32.31%), Postives = 70/130 (53.85%), Query Frame = -3
Query:  216 DED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLAL-LGH 599
            DED +I I+  RS  Q       +K+ +G D+  DL+++      DL R  +  ++ P HY  K L+ A+   GTDE AL  ++ TR   +++ I + Y+      L+ A+  DTSG + ++L++L  GH
Sbjct:  382 DEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSEISG---DLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRRILISLATGH 508          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_HORSE (Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 3.523e-12
Identity = 39/121 (32.23%), Postives = 66/121 (54.55%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL TRS   +      Y     +D+++ L+ + K +  +   A V+C      +F + L  A+   GT +  L R++ +R+EVD+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTTRSYPHLRRVFQMYTKYSKHDMNKVLDLEMKGDVENCFTAIVKCATSKPMFFAEKLHNAMKGAGTRDKILIRIMVSRSEVDMNDIKACYQKLYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_BOVIN (Annexin A1 OS=Bos taurus GN=ANXA1 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.601e-12
Identity = 39/123 (31.71%), Postives = 66/123 (53.66%), Query Frame = -3
Query:  219 IRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 587
            I IL TRS   +     +Y     +D+++ L+ + K +    L   V+C      +F + L  A+   GT    L R++ +R+E+D+  IK  YQ+   + L +A++ +T GDYEK+L+AL G
Sbjct:  222 ITILTTRSYPHLRRVFQKYSKYSKHDMNKVLDLELKGDIEKCLTVIVKCATSQPMFFAEKLHQAMKGIGTRHKTLIRIMVSRSEIDMNDIKACYQKLYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA6_MOUSE (Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 6.009e-12
Identity = 38/139 (27.34%), Postives = 70/139 (50.36%), Query Frame = -3
Query:  189 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGDA*VVPYF 605
            +++   I IL  RSK  +    ++Y    G  I+  +  +   ++  L+ A V+C+     YF + L  A+   GT +  L R++ +R+E+D+  I++ ++ +    L   +  DTSG+Y+K LL L G  D     +F
Sbjct:  194 TDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKALLKLCGGDDDAAAQFF 332          

HSP 2 Score: 70.8626 bits (172), Expect = 6.009e-12
Identity = 43/135 (31.85%), Postives = 69/135 (51.11%), Query Frame = -3
Query:  210 NKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            +KTS +   + +L TRS   +     ++      DI+  ++ +   +  D   A VQ +     +F   L  ++   GTDE  LTRV+ +R+E+DL  I+ E+  +    L +A+  DTSGD+ K LLAL G  D
Sbjct:  539 DKTSLETRFMTVLCTRSYPHLRRVFQEFIKKTNYDIEHVIKKEMSGDVKDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRVMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFMKALLALCGGED 673          

HSP 3 Score: 67.0106 bits (162), Expect = 8.677e-11
Identity = 37/127 (29.13%), Postives = 68/127 (53.54%), Query Frame = -3
Query:  225 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLAL 605
            +++  +I I+  RS AQ       +K+ +G D+  DL+++      DL R  +  ++ P HY  K L+ A+   GTDE  L  ++ TR   +++ I + Y+      L+ A+  DTSG + ++L++L
Sbjct:  381 TDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSEISG---DLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRRILISL 504          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA6_BOVIN (Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 7.848e-12
Identity = 42/126 (33.33%), Postives = 70/126 (55.56%), Query Frame = -3
Query:  225 DED-LIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLAL 599
            DED +I I+A RS AQ       +K+ +G D+  DL+++      DL R  +  ++ P HY  K L+ A+   GTDE AL  ++ TR   +++ I   Y+      L+ A+  DTSG ++++L++L
Sbjct:  382 DEDTIIDIIAHRSNAQRQQIRQTFKSHFGRDLMADLKSELSG---DLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIQAINKAYKEDYHKSLEDALSSDTSGHFKRILISL 504          

HSP 2 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 37/132 (28.03%), Postives = 68/132 (51.52%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   I IL  RSK  +    ++Y    G  I+  +  +   ++  L+ A V+C+     YF + L  A+   GT +  L R++ +R+E+D+  I++ ++ +    L   +  DTSG+Y+K LL L G  D
Sbjct:  194 TDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTAEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLCGGDD 325          

HSP 3 Score: 67.781 bits (164), Expect = 5.087e-11
Identity = 39/135 (28.89%), Postives = 70/135 (51.85%), Query Frame = -3
Query:  210 NKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            +K+S +   + IL TRS   +     ++  +   D++  ++ +   +  D+  A VQ +     +F   L  ++   GTDE  LTR++ +R+E+DL  I+ E+  +    L +A+  DTSG + K LLA+ G  D
Sbjct:  539 DKSSLETRFMMILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDVFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGHFLKALLAICGGED 673          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA1_MOUSE (Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 7.848e-12
Identity = 38/121 (31.40%), Postives = 66/121 (54.55%), Query Frame = -3
Query:  219 ILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 581
            IL +RS   +      Y     +D+++ L+ + K +    L   V+C      +F + L  A+   GT   AL R++ +R+E+D+  IK  YQ++  + L +A++ +T GDYEK+L+AL G
Sbjct:  224 ILTSRSFPHLRRVFQNYGKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAFFAEKLYEAMKGAGTRHKALIRIMVSRSEIDMNEIKVFYQKKYGISLCQAILDETKGDYEKILVALCG 344          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA8_RAT (Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 36/129 (27.91%), Postives = 66/129 (51.16%), Query Frame = -3
Query:  219 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLG 605
            +++   I IL TRS   +     +Y+ +    I+  ++++      + +   V+C      YF + L  A+   GT +G L R + +R+E+DL +IK ++Q+     L   ++ DTSG Y+  LL L+G
Sbjct:  196 TDEMKFITILCTRSATHLMRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTRNVHSYFAERLYYAMKGAGTLDGTLIRNIVSRSEIDLNLIKSQFQKMYGKTLSSMIMGDTSGYYKTALLNLVG 324          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA6_RAT (Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 37/132 (28.03%), Postives = 68/132 (51.52%), Query Frame = -3
Query:  210 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 605
            +++   I IL  RSK  +    ++Y    G  I+  +  +   ++  L+ A V+C+     YF + L  A+   GT +  L R++ +R+E+D+  I++ ++ +    L   +  DTSG+Y+K LL L G  D
Sbjct:  194 TDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKALLKLCGGDD 325          

HSP 2 Score: 68.1662 bits (165), Expect = 3.895e-11
Identity = 37/127 (29.13%), Postives = 69/127 (54.33%), Query Frame = -3
Query:  225 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLAL 605
            +++  +I I+  RS  Q       +K+ +G D+  DL+++      DL R  +  ++ P HY  K L+ A+   GTDE AL  ++ TR   +++ I + Y+      L+ A+  DTSG ++++L++L
Sbjct:  381 TDEATIIDIITQRSNVQRQQIRQTFKSHFGRDLMADLKSEISG---DLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFKRILISL 504          

HSP 3 Score: 68.1662 bits (165), Expect = 3.895e-11
Identity = 42/135 (31.11%), Postives = 68/135 (50.37%), Query Frame = -3
Query:  210 NKTSNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGD 614
            +KTS +   + +L TRS   +     ++      DI+  ++ +   +  D   A VQ +     +F   L  ++   GTDE  LTRV+ +R+E+DL  I+ E+  +      +A+  DTSGD+ K LLAL G  D
Sbjct:  539 DKTSLETRFMTVLCTRSYPHLRRVFQEFIKKTNYDIEHVIKKEMSGDVKDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRVMVSRSEIDLLNIRREFIEKYDKSPHQAIEGDTSGDFMKALLALCGGED 673          
BLAST of DC900049 vs. ExPASy Swiss-Prot
Match: ANXA6_CHICK (Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.025e-11
Identity = 37/139 (26.62%), Postives = 71/139 (51.08%), Query Frame = -3
Query:  189 SNDEDLIRILATRSKAQINATLNQYKNVYGNDIDQDLEADPKDEYLDLLRATVQCLVRPEHYFEKILRLAINKQGTDEGALTRVVTTRAEVDLKVIKDEYQRRNSVPLDRAVVKDTSGDYEKMLLALLGHGDA*VVPYF 605
            +++   I IL  RSK  +    ++Y  + G  I++ + A+   ++  L  A V+C+     YF + L  A+   GT +  L  ++ +R+E+D+  I++ ++ +    L   + +DTSG+Y+K LL L    D     +F
Sbjct:  192 TDEAQFIYILGRRSKQHLRMVFDEYLKISGKPIERSIRAELSGDFEKLKLAVVKCVRSTAEYFAERLYKAMKGLGTRDNTLIHIMVSRSEIDMLDIREVFRTKYDKSLHNMIKEDTSGEYKKALLKLCEGDDDAAAEFF 330          
The following BLAST results are available for this feature:
BLAST of DC900049 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
ANXA8_HUMAN1.211e-1227.91Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3[more]
ANXA6_HUMAN2.697e-1231.11Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3[more]
ANXA1_HORSE3.523e-1232.23Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3[more]
ANXA1_BOVIN4.601e-1231.71Annexin A1 OS=Bos taurus GN=ANXA1 PE=2 SV=2[more]
ANXA6_MOUSE6.009e-1227.34Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2[more]
ANXA6_BOVIN7.848e-1233.33Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2[more]
ANXA1_MOUSE7.848e-1231.40Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2[more]
ANXA8_RAT1.025e-1127.91Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1[more]
ANXA6_RAT1.025e-1128.03Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2[more]
ANXA6_CHICK1.025e-1126.62Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900049 VSS Citrus sinensis cDNA clone VS27Q55 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900049 ID=DC900049|Name=DC900049|organism=Citrus sinensis|type=EST|length=622bp
AAAGTAGCAGTTTCATANCAAATGCTGTCACCATCTTATTTATAAGATCA
TAGATTAAGTTTTTCAACCGGCATAACCAAAAGACTGAAAATAAAACGAT
CATCACACATGGATAGAGAACACTGCAAACTCCAAGCAACAGCAAACCTA
GATAAATAAAACACATATATTGCCTCTCAATCCTTCAAGAAATAGGGAAC
AACTCAAGCATCCCCATGTCCTAAAAGTGCCAGAAGCATTTTTTCGTAGT
CCCCAGAGGTGTCCTTGACAACGGCGCGATCCAGAGGAACACTGTTCCTC
CTCTGGTACTCATCTTTTATGACCTTCAAGTCGACCTCGGCCCTTGTGGT
GACGACTCTAGTAAGAGCCCCTTCATCTGTTCCCTGTTTGTTAATTGCCA
GACGAAGTATCTTCTCAAAATAATGTTCAGGGCGGACTAAGCACTGAACT
GTGGCCCTCAGTAGGTCGAGGTACTCATCTTTAGGGTCAGCCTCTAAGTC
CTGATCAATATCATTCCCATATACATTCTTGTATTGATTCAGAGTCGCAT
TGATCTGNGCTTTGCTCCTTGTAGCCAAGATCCTGATGAGATCCTCATCA
TTGGAGGTCTTATTCGAAATCT
back to top