DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA8_RAT (Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.364e-16
Identity = 46/128 (35.94%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R+  QR+ I +++   +G+DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  +LEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNVQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSTLEEDIQGDTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA8_MOUSE (Annexin A8 OS=Mus musculus GN=Anxa8 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.364e-16
Identity = 46/128 (35.94%), Postives = 74/128 (57.81%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            D E L KA +G GTNEQ II +L  R+  QR+ I +++   +G+DL ++L  EL+  FER+++     P   +A   ++A K   +   V++EI  +R+  QL E  +AY   +  +LEED+   T+G
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNVQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYSYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSTLEEDIQGDTSG 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA7_DICDI (Annexin A7 OS=Dictyostelium discoideum GN=nxnA PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.364e-16
Identity = 46/142 (32.39%), Postives = 83/142 (58.45%), Query Frame = 3
Query:  126 VPSVTEDC----EQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            V ++T DC    E LRKA +G GTNE  +I +LA+RN A+R+ I++ ++  Y +DL++ +  E + +FE+ ++    +PA  D    + A     ++   ++EI  TRS+ Q+   +Q +  +  KSL++ +    +GDF+K
Sbjct:  156 VGTITHDCKHDAEVLRKAMKGIGTNESDLIKVLANRNWAEREQIKREFSAKYSKDLIQDIKSETSGNFEKCLVALLTEPAHFDVEQIHSACAGAGTNENTIIEILVTRSNVQMEYIKQIFKNKHGKSLKDRLESEASGDFKK 297          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_PANTR (Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 7.443e-16
Identity = 46/132 (34.85%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E+ I+++L  R+ AQR+ I   +   +G DLL  L  ELT  FE++++         DA+    A K   ++ +VL EI  +R+ ++L   +Q Y   +  SLE+DV   T+G +++
Sbjct:   20 DAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_HUMAN (Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 7.443e-16
Identity = 46/132 (34.85%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E+ I+++L  R+ AQR+ I   +   +G DLL  L  ELT  FE++++         DA+    A K   ++ +VL EI  +R+ ++L   +Q Y   +  SLE+DV   T+G +++
Sbjct:   20 DAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_BOVIN (Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 1.658e-15
Identity = 46/132 (34.85%), Postives = 73/132 (55.30%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E+ I+++L  R+ AQR+ I   +   +G DLL  L  ELT  FE++++         DA+    A K   +  +VL EI  +R+ ++L    Q Y   +  SLE+DV   T+G +++
Sbjct:   20 DAETLRKAMKGLGTDEETILTLLTSRSNAQRQEIAVAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIEQVYEEEYGSSLEDDVVGDTSGYYQR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_MOUSE (Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.166e-15
Identity = 45/132 (34.09%), Postives = 74/132 (56.06%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E  I+++L  R+ AQR+ I Q +   +G DL+  L  ELT  FE++++         DA+    A K   +  +VL EI  +R+ ++L   +Q Y   +  +LE+DV   T+G +++
Sbjct:   18 DAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQR 149          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_MACFA (Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 2.166e-15
Identity = 45/132 (34.09%), Postives = 74/132 (56.06%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E+ I+++L  R+ AQR+ I   +   +G DLL  L  ELT  FE++++         DA+    A K   +  +VL EI  +R+ ++L   ++ Y   +  SLE+DV   T+G +++
Sbjct:   20 DAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKEVYEEEYGSSLEDDVVGDTSGYYQR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXB9_DROME (Annexin-B9 OS=Drosophila melanogaster GN=AnnIX PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 2.828e-15
Identity = 49/141 (34.75%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PA      ED   LRKA +G+GT+E+ II ILA R   QR  I + +  +YG+DL+  L  EL   FE V++       +  A   ++A     +  + ++EI CT S+  +    Q Y   F KSLE D+   T+G F++
Sbjct:   17 PADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKR 157          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA7_XENLA (Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.828e-15
Identity = 43/132 (32.58%), Postives = 77/132 (58.33%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E+LRKA +G+GT+E+ I  ++A+R+  QR+ I+  +   YG+DL+K L  EL+ + E +++   +     DA+    A K   +  +VL+EI CTR++ ++      Y   F + +E+D+   T+G F +
Sbjct:  214 DAEKLRKAMKGFGTDEKPI-DVVANRSNDQRQKIQAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPSTYYDAWSLYNAMKGAGTQERVLIEILCTRTNSEIRNIVACYKQEFGREIEKDIRSDTSGHFER 344          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA8_RAT4.364e-1635.94Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1[more]
ANXA8_MOUSE4.364e-1635.94Annexin A8 OS=Mus musculus GN=Anxa8 PE=2 SV=1[more]
ANXA7_DICDI4.364e-1632.39Annexin A7 OS=Dictyostelium discoideum GN=nxnA PE=... [more]
ANXA5_PANTR7.443e-1634.85Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3[more]
ANXA5_HUMAN7.443e-1634.85Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2[more]
ANXA5_BOVIN1.658e-1534.85Annexin A5 OS=Bos taurus GN=ANXA5 PE=1 SV=3[more]
ANXA5_MOUSE2.166e-1534.09Annexin A5 OS=Mus musculus GN=Anxa5 PE=1 SV=1[more]
ANXA5_MACFA2.166e-1534.09Annexin A5 OS=Macaca fascicularis GN=ANXA5 PE=2 SV... [more]
ANXB9_DROME2.828e-1534.75Annexin-B9 OS=Drosophila melanogaster GN=AnnIX PE=... [more]
ANXA7_XENLA2.828e-1532.58Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top