DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_RAT (Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3)

HSP 1 Score: 82.0333 bits (201), Expect = 2.828e-15
Identity = 44/132 (33.33%), Postives = 75/132 (56.82%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E  I+++L  R+ AQR+ I + +   +G DL+  +  ELT  FE++++         DA+    A K   +  +VL EI  +R+ ++L   +QAY   +  +LE+DV   T+G +++
Sbjct:   18 DAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQR 149          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_MOUSE (Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 6.301e-15
Identity = 50/136 (36.76%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +V+ D   L KA    G +E  II IL  R  AQR+ I+  Y    G+ L + L K LT   E VV+     PA+ DA     A K   +    L+EI  TRS++Q+ E  + Y    K+ L +D+   T+GDFRK
Sbjct:   43 NVSSDVAALHKAIMVKGVDEATIIDILTKRTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDADELRGAMKGLGTDEDTLIEILTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFRK 178          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_CHICK (Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.075e-14
Identity = 47/133 (35.34%), Postives = 74/133 (55.64%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAE-RDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D E LRKA +G GT+E+ I+ IL  RN AQR+ I   +   +G DL+  L  ELT  FE  +M+  + PA   DA     A K   ++ +VL EI  +R+  ++   +Q Y   ++ +LE+ +   T+G F++
Sbjct:   20 DAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFE-TLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX12_HYDAT (Annexin-B12 OS=Hydra attenuata GN=ANXB12 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.404e-14
Identity = 45/133 (33.83%), Postives = 75/133 (56.39%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            ED E LRKA +G GT+E+ I  ILA R+ AQR+ I+  Y   +G+ L   L  EL+ ++E   +     P E  A   + A K   +    L++I CT+S+ Q+   + A+   +K+ LE+++   T+G+F++
Sbjct:   17 EDAETLRKAMKGIGTDEKSITHILATRSNAQRQQIKTDYTTLFGKHLEDELKSELSGNYEAAALALLRKPDEFLAEQLHAAMKGLGTDENALIDILCTQSNAQIHAIKAAFKLLYKEDLEKEIISETSGNFQR 149          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_HORSE (Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 2.394e-14
Identity = 53/174 (30.46%), Postives = 81/174 (46.55%), Query Frame = 3
Query:   18 SLVLDSAQHTESDLS*VLKEEQGDHETMSTLTVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            S  L  A   E++    +K  +G      +   P    + + D + L KA    G +E  II IL  RN AQR+ I+  Y    G+ L ++L K LT   E V +     PA  DA     A K   +    L+EI  +R++K++ E  + Y    K+ L +D+   T+GDF+K
Sbjct:    5 SAFLKQAWFIENEEQEYIKAVKGSKGGPGSAVSPYPSFNPSSDVDALHKAITVKGVDEATIIEILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEDVALALLKTPARFDADELRAAMKGLGTDEDTLIEILTSRTNKEIREINRVYREELKRDLAKDITSDTSGDFQK 178          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_RAT (Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 48/133 (36.09%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            + D   L KA    G +E  II IL  R  AQR+ I+  Y    G+ L ++L K LT   E VV+     PA+ DA     A K   +    L+EI  TRS++Q+ E  + Y    K+ L +D+   T+GDFR
Sbjct:   45 SSDVAALHKAIMVKGVDEATIIDILTKRTNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLAMLKTPAQFDADELRAAMKGLGTDEDTLIEILTTRSNQQIREITRVYREELKRDLAKDITSDTSGDFR 177          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX10_MOUSE (Annexin A10 OS=Mus musculus GN=Anxa10 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 41/131 (31.30%), Postives = 73/131 (55.73%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            D + L    +G+  N+ ++I IL  R+ AQR++I  TY   YG DL+  L ++L++ F+ V++     P   DA     A K   +    L+EI  +R++ ++ + R+AY  ++  +L+ED+   T+G FR
Sbjct:   22 DAQMLGGRLQGFDCNKDMLIDILTQRSNAQRQMIAGTYQSMYGRDLISVLKEQLSSHFKEVMVGLMYPPPSYDAHELWHAMKGPGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFR 152          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_RABIT (Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.084e-14
Identity = 50/141 (35.46%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  117 PAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            PA  PS   D   L +A    G +E  II IL  RN AQR+ I+  Y    G+ L + L K LT   E VV+     PA+ DA     A K   +    L+EI  +R++K++ E  + Y    K+ L +D+   T+GDF+K
Sbjct:   40 PAFNPS--SDVAALHQAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEVLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRNNKEIREINRVYREELKRDLAKDIASDTSGDFQK 178          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_PANTR (Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.084e-14
Identity = 46/133 (34.59%), Postives = 68/133 (51.13%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            + D   L KA    G +E  II IL  RN AQR+ I+  Y    G+ L ++L K LT   E VV+     PA+ DA     A K   +    L+EI  +R++K++ +  + Y    K+ L +D+   T+GDFR
Sbjct:   45 SSDVAALHKAIMVKGVDEATIIDILTRRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFR 177          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_HUMAN (Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 5.334e-14
Identity = 46/133 (34.59%), Postives = 68/133 (51.13%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            + D   L KA    G +E  II IL  RN AQR+ I+  Y    G+ L ++L K LT   E VV+     PA+ DA     A K   +    L+EI  +R++K++ +  + Y    K+ L +D+   T+GDFR
Sbjct:   45 SSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFR 177          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA5_RAT2.828e-1533.33Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3[more]
ANXA1_MOUSE6.301e-1536.76Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2[more]
ANXA5_CHICK1.075e-1435.34Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2[more]
ANX12_HYDAT1.404e-1433.83Annexin-B12 OS=Hydra attenuata GN=ANXB12 PE=1 SV=1[more]
ANXA1_HORSE2.394e-1430.46Annexin A1 OS=Equus caballus GN=ANXA1 PE=2 SV=3[more]
ANXA1_RAT3.127e-1436.09Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2[more]
ANX10_MOUSE3.127e-1431.30Annexin A10 OS=Mus musculus GN=Anxa10 PE=2 SV=1[more]
ANXA1_RABIT4.084e-1435.46Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 ... [more]
ANXA1_PANTR4.084e-1434.59Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1[more]
ANXA1_HUMAN5.334e-1434.59Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top