DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_CAVCU (Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.334e-14
Identity = 46/134 (34.33%), Postives = 68/134 (50.75%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            + D   L KA    G +E  II IL  RN AQR+ I+  Y    G+ L ++L K LT   E VV+     PA+ DA     A K   +    L+EI  +R ++++ E  + Y    K+ L +D+   T+GDF+K
Sbjct:   45 SSDVAALHKAITVKGVDEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEEVVLALLKTPAQLDADELRAAMKGLGTDEDTLIEILVSRKNREIKEINRVYRDELKRDLAKDITSDTSGDFQK 178          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA1_PONAB (Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.967e-14
Identity = 45/133 (33.83%), Postives = 68/133 (51.13%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            + D   L KA    G +E  II +L  RN AQR+ I+  Y    G+ L ++L K LT   E VV+     PA+ DA     A K   +    L+EI  +R++K++ +  + Y    K+ L +D+   T+GDFR
Sbjct:   45 SSDVAALHKAIMVKGVDEATIIDVLTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFR 177          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA5_CYNPY (Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.647e-13
Identity = 42/133 (31.58%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            ED E LR A +G GT+E  I+ +L  R+  QR+ I  TY   +G DL   L  EL+  FE +++   +     DA     A K   +   V++EI  +R++ ++   ++ Y   F   LE+D+   T+G+F +
Sbjct:   21 EDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFER 153          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA9_MOUSE (Annexin A9 OS=Mus musculus GN=Anxa9 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.898e-13
Identity = 44/132 (33.33%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            SV +D ++L KA  G G +   I+ +L +R+  QR+LI + + +   +DLLKSL   L+ + E++V+      A+ DA     A K   S+  V +EI  TR++  L      Y   F+   EED+   TNG
Sbjct:   42 SVDKDVQRLLKAIAGQGVDYDTIVDVLTNRSREQRQLISRAFQERTKQDLLKSLQAALSGNLEKIVVALLQPAAQFDAQELRTALKTSGSAEDVALEILATRAAPGLQACLAVYKHDFQVEAEEDIRTETNG 173          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA9_HUMAN (Annexin A9 OS=Homo sapiens GN=ANXA9 PE=1 SV=3)

HSP 1 Score: 74.3294 bits (181), Expect = 5.898e-13
Identity = 43/132 (32.58%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNG 527
            SV +D ++L +A  G G +   I+ +L +R+  QR+LI + + +   +DL+KSL   L+ + ER+VM      A+ DA     A K   S+  V +EI  TR+  QL E    Y   F+    +D+   T+G
Sbjct:   42 SVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSG 173          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX10_DROME (Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.898e-13
Identity = 41/134 (30.60%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  138 TEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            ++D + LR A +G+GT+EQ II +L  R+  QR+ I+  Y   +  DL+  L  EL   FE V++   + P E      + A     +    L+EI CT++++++ +    Y  R+++ L E +   T+G FR+
Sbjct:   18 SQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQRQTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAMAGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFRR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX11_DROME (Annexin-B11 OS=Drosophila melanogaster GN=Anxb11 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.006e-12
Identity = 39/142 (27.46%), Postives = 78/142 (54.93%), Query Frame = 3
Query:  114 VPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            VPA      +D   LRKA +G+GT+E  +I+I+  R+  QR+ I++ +   +G+DL++ +  E + +FE++++       +      N+A     +  +VL+EI CT S+ ++   +  Y   +   LE ++   T+G+F++
Sbjct:   10 VPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAHLESELKSETSGNFKR 151          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA9_BOVIN (Annexin A9 OS=Bos taurus GN=ANXA9 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.314e-12
Identity = 45/135 (33.33%), Postives = 67/135 (49.63%), Query Frame = 3
Query:  132 SVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            S  +D ++L KA  G G +   I+ +L +R+  QR+LI + + +   +DLLKSL   L+ + ER+V+      A  DA     A K   S+  V +EI  TR+  QL E    Y   F+    ED+   T G  R
Sbjct:   42 SADKDVQRLLKAIAGQGVDRIAILDVLTNRSREQRQLISRAFHERTQQDLLKSLQAALSGNLERIVVALLQPAAHLDARELRTALKGSGSAEDVALEILATRTPPQLQECLAVYKHNFQVDAAEDIKSETRGILR 176          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX10_HUMAN (Annexin A10 OS=Homo sapiens GN=ANXA10 PE=1 SV=3)

HSP 1 Score: 72.7886 bits (177), Expect = 1.716e-12
Identity = 39/131 (29.77%), Postives = 72/131 (54.96%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFR 536
            D + L  A +G+  ++ ++I+IL  R  AQR +I + Y   YG DL+  + ++L++ F+ V+      P   DA     A K   +    L+EI  +R++ ++ + R+AY  ++  +L+ED+   T+G FR
Sbjct:   22 DAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFR 152          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_PONAB (Annexin A2 OS=Pongo abelii GN=ANXA2 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.993e-12
Identity = 48/156 (30.77%), Postives = 79/156 (50.64%), Query Frame = 3
Query:   81 QGDHETMSTL--TVPAQVPSVTE-DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +   +V A      E D   +  A +  G +E  I++IL +R+ AQR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK 169          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA1_CAVCU5.334e-1434.33Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1[more]
ANXA1_PONAB6.967e-1433.83Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1[more]
ANXA5_CYNPY2.647e-1331.58Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1[more]
ANXA9_MOUSE5.898e-1333.33Annexin A9 OS=Mus musculus GN=Anxa9 PE=2 SV=2[more]
ANXA9_HUMAN5.898e-1332.58Annexin A9 OS=Homo sapiens GN=ANXA9 PE=1 SV=3[more]
ANX10_DROME5.898e-1330.60Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=... [more]
ANX11_DROME1.006e-1227.46Annexin-B11 OS=Drosophila melanogaster GN=Anxb11 P... [more]
ANXA9_BOVIN1.314e-1233.33Annexin A9 OS=Bos taurus GN=ANXA9 PE=2 SV=1[more]
ANX10_HUMAN1.716e-1229.77Annexin A10 OS=Homo sapiens GN=ANXA10 PE=1 SV=3[more]
ANXA2_PONAB4.993e-1230.77Annexin A2 OS=Pongo abelii GN=ANXA2 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top