DC900048

Overview
NameDC900048
Unique NameDC900048
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4158 contig Csv1_Contig4158:7..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_MOUSE (Annexin A2 OS=Mus musculus GN=Anxa2 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.236e-11
Identity = 45/156 (28.85%), Postives = 75/156 (48.08%), Query Frame = 3
Query:   81 QGDHETMSTL---TVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +      P        D   +  A +  G +E  I++IL +R+  QR+ I   Y     ++L  +L   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+GDFRK
Sbjct:   14 EGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNILTNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX2B_XENLA (Annexin A2-B OS=Xenopus laevis GN=anxa2-B PE=2 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 4.227e-11
Identity = 42/133 (31.58%), Postives = 70/133 (52.63%), Query Frame = 3
Query:  141 EDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +D   +  A +  G +E  II+IL +R+  QR+ I   +     +DL  +L   L+ + E V++       + DA     + K   +    L+EI C+R++K+LL+ + AY   FK  LE+D+   T+GDFRK
Sbjct:   38 KDAAAIETAIKTKGVDELTIINILTNRSNEQRQDIAFAFHRRTKKDLPSALKGALSGNLETVMLGLIKTRPQYDASELKASMKGLGTDEDTLIEIICSRTNKELLDIQNAYRELFKTELEKDIMSDTSGDFRK 170          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANXA2_RAT (Annexin A2 OS=Rattus norvegicus GN=Anxa2 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 7.209e-11
Identity = 44/156 (28.21%), Postives = 76/156 (48.72%), Query Frame = 3
Query:   81 QGDHETMSTL---TVPAQVPSVTEDCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            +GDH T  +      P        D   +  A +  G +E  I++IL +R+ AQR+ I   Y     ++L  ++   L+   E V++     PA+ DA     + K   +    L+EI C+R++++L E  + Y   +K  LE+D+   T+G+FRK
Sbjct:   14 EGDHSTPPSAYGSVKPYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELPSAMKSALSGHLETVMLGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGEFRK 169          
BLAST of DC900048 vs. ExPASy Swiss-Prot
Match: ANX11_COLLI (Annexin A1 isoform p35 OS=Columba livia GN=CP35 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.209e-11
Identity = 42/132 (31.82%), Postives = 66/132 (50.00%), Query Frame = 3
Query:  144 DCEQLRKAFEGWGTNEQLIISILAHRNAAQRKLIRQTYADTYGEDLLKSLDKELTNDFERVVMLWTLDPAERDAFLANEATKRWTSSNQVLMEIACTRSSKQLLEARQAYHARFKKSLEEDVGYHTNGDFRK 539
            D   L KA    G +E  II I+  R  AQR  I+  Y    G+ L +++ + L +  E VV+     PA+ DA       K   +    L+EI  +R++K++ EA + Y    K+ L +D+   T+GDF+K
Sbjct:   42 DVVALEKAMTAKGVDEATIIDIMTTRTNAQRPRIKAAYHKAKGKSLEEAMKRVLKSHLEDVVVALLKTPAQFDAEELRACMKGHGTDEDTLIEILASRNNKEIREACRYYKEVLKRDLTQDIISDTSGDFQK 173          
The following BLAST results are available for this feature:
BLAST of DC900048 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
ANXA2_MOUSE3.236e-1128.85Annexin A2 OS=Mus musculus GN=Anxa2 PE=1 SV=2[more]
ANX2B_XENLA4.227e-1131.58Annexin A2-B OS=Xenopus laevis GN=anxa2-B PE=2 SV=... [more]
ANXA2_RAT7.209e-1128.21Annexin A2 OS=Rattus norvegicus GN=Anxa2 PE=1 SV=2[more]
ANX11_COLLI7.209e-1131.82Annexin A1 isoform p35 OS=Columba livia GN=CP35 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900048 VSS Citrus sinensis cDNA clone VS27Q55 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900048 ID=DC900048|Name=DC900048|organism=Citrus sinensis|type=EST|length=644bp
GTCCTTCTTGNGTAGAGAGTCTCGTTCTCGATTCTGCGCAGCACACAGAA
TCAGATTTGAGTTAAGTTCTGAAAGAAGAACAAGGAGATCACGAAACAAT
GTCAACACTTACAGTTCCAGCGCAAGTTCCATCTGTTACCGAAGACTGTG
AGCAGCTCAGAAAAGCCTTTGAAGGATGGGGAACAAACGAGCAACTGATC
ATATCGATACTGGCTCACAGAAATGCTGCTCAACGCAAGTTGATTCGACA
AACATATGCTGATACTTACGGCGAAGACCTCCTCAAGTCGCTCGATAAGG
AACTCACTAATGACTTTGAGAGGGTGGTGATGCTCTGGACTCTTGATCCT
GCTGAACGTGATGCCTTTTTGGCTAATGAAGCCACTAAGAGGTGGACTTC
TAGCAACCAGGTTCTTATGGAAATTGCATGCACCAGGTCTTCGAAGCAAT
TGCTCGAAGCAAGGCAGGCTTATCATGCTCGTTTTAAGAAGTCCCTTGAA
GAGGATGTTGGTTATCACACCAATGGGGACTTCCGCAAGCTTTTGCTACC
CTTGTGACTGNCTACCGATATGAGGGTGATGAGGNGACATTACACTTGCA
AATCAGAAGCTAGATTTCATGAGAGATTCGATAGACTACATGAT
back to top