DC900047
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL3_ORYSJ (COBRA-like protein 3 OS=Oryza sativa subsp. japonica GN=BC1L4 PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 6.481e-14 Identity = 33/51 (64.71%), Postives = 37/51 (72.55%), Query Frame = 3 Query: 27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLPN 179 G GN Q+E+LL KDS FTF +GW FP R+ FNGD CVMP PD YP LPN Sbjct: 380 GPLGNAQSELLLRKDSKDFTFDKGWAFPHRVYFNGDNCVMPPPDAYPWLPN 430 HSP 2 Score: 20.7866 bits (42), Expect = 6.481e-14 Identity = 7/9 (77.78%), Postives = 9/9 (100.00%), Query Frame = 2 Query: 2 YNDMLLQAG 28 YND+L+QAG Sbjct: 372 YNDLLMQAG 380
BLAST of DC900047 vs. ExPASy Swiss-Prot
Match: COBL2_ORYSJ (COBRA-like protein 2 OS=Oryza sativa subsp. japonica GN=BC1L2 PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 5.863e-13 Identity = 32/50 (64.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 27 GXSGNVQTEMLLHKDSGIFTFREGWGFPRRILFNGDECVMPLPDDYPRLP 176 G GNVQ+E+L KD FTF +GW FPRRI FNG+ CVMP PD YP LP Sbjct: 371 GPDGNVQSELLFRKDRSTFTFDKGWAFPRRIYFNGESCVMPSPDLYPWLP 420 The following BLAST results are available for this feature:
BLAST of DC900047 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DC900047 ID=DC900047; Name=DC900047; organism=Citrus sinensis; type=EST; length=565bpback to top |