DC900044

Overview
NameDC900044
Unique NameDC900044
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length488
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12693 contig Csv1_Contig12693:388..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROMD (60S ribosomal protein L32 OS=Drosophila madeirensis GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.072e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRIYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROGU (60S ribosomal protein L32 OS=Drosophila guanche GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.072e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRIYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DROBF (60S ribosomal protein L32 OS=Drosophila bifasciata GN=RpL32 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.072e-17
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            +KF+VHNV ELE+L+M NR YC EIAH VS+KKRKEIVERA QL + +TN   RLRSQE E
Sbjct:   74 KKFLVHNVRELEVLLMQNRIYCGEIAHAVSSKKRKEIVERAKQLSIRLTNPNGRLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_APIME (60S ribosomal protein L32 OS=Apis mellifera GN=RpL32 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.522e-15
Identity = 42/61 (68.85%), Postives = 47/61 (77.05%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            RK +VHNV ELE+LMM NR +CAEIAH  S+KKRK IVERA QL + VT   ARLRSQE E
Sbjct:   74 RKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVTYASARLRSQENE 134          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32P_MOUSE (Putative 60S ribosomal protein L32' OS=Mus musculus GN=Rpl32-ps PE=5 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.871e-14
Identity = 39/61 (63.93%), Postives = 48/61 (78.69%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            RKF+VHN+ E E+L+M N++Y AEIAHNVS+K RK IVERAAQL + VTN   RL S+E E
Sbjct:   75 RKFLVHNIKEPEVLLMCNKSYRAEIAHNVSSKNRKAIVERAAQLAIRVTNPNTRLHSEENE 135          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_MAIZE (60S ribosomal protein L32 (Fragment) OS=Zea mays GN=RPL32 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.236e-13
Identity = 36/42 (85.71%), Postives = 38/42 (90.48%), Query Frame = 2
Query:   62 TYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            TYCAEIAHNVSTKKRKEIVERAAQLD+VV  KLAR  SQE+E
Sbjct:    1 TYCAEIAHNVSTKKRKEIVERAAQLDIVVPTKLARAPSQEDE 42          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_DICDI (60S ribosomal protein L32 OS=Dictyostelium discoideum GN=rpl32 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.236e-13
Identity = 36/61 (59.02%), Postives = 45/61 (73.77%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQEEE 187
            ++FV+ NV ELE+L+M NR Y A I H VS K RK IVERAA+L++ VT   ARLRS+E E
Sbjct:   73 KRFVIRNVQELEVLLMQNRRYAAVIFHGVSAKSRKAIVERAAELNIKVTTPNARLRSEERE 133          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32B_SCHPO (60S ribosomal protein L32-B OS=Schizosaccharomyces pombe GN=rpl32b PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.236e-13
Identity = 36/59 (61.02%), Postives = 47/59 (79.66%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQE 181
            + F+V NV+++ELL+MHN+TY AEIA NVS +KR EIVE+A  L V VTN  A++RSQE
Sbjct:   69 KAFLVRNVSDVELLLMHNKTYAAEIASNVSARKRVEIVEKARALGVKVTNAGAKVRSQE 127          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32A_SCHPO (60S ribosomal protein L32-A OS=Schizosaccharomyces pombe GN=rpl32a PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.206e-12
Identity = 36/59 (61.02%), Postives = 47/59 (79.66%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQE 181
            + F+V NV+++ELL+MHN+TY AEIA NVS +KR EIVE+A  L V VTN  A++RSQE
Sbjct:   69 KAFLVRNVSDVELLLMHNKTYAAEIAGNVSARKRVEIVEKARALGVKVTNAGAKVRSQE 127          
BLAST of DC900044 vs. ExPASy Swiss-Prot
Match: RL32_NEUCR (60S ribosomal protein L32 OS=Neurospora crassa GN=rpl-32 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.510e-12
Identity = 33/58 (56.90%), Postives = 46/58 (79.31%), Query Frame = 2
Query:    5 RKFVVHNVNELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVTNKLARLRSQ 178
            + F+V NV ++ELL+MHN+TY AEIAHNVS++KR EI+ RA QL V VTN  A++ ++
Sbjct:   73 KAFLVSNVKDVELLLMHNKTYAAEIAHNVSSRKRIEIIARAKQLSVKVTNAKAKVTTE 130          
The following BLAST results are available for this feature:
BLAST of DC900044 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
RL32_DROMD8.072e-1768.8560S ribosomal protein L32 OS=Drosophila madeirensi... [more]
RL32_DROGU8.072e-1768.8560S ribosomal protein L32 OS=Drosophila guanche GN... [more]
RL32_DROBF8.072e-1768.8560S ribosomal protein L32 OS=Drosophila bifasciata... [more]
RL32_APIME1.522e-1568.8560S ribosomal protein L32 OS=Apis mellifera GN=RpL... [more]
RL32P_MOUSE2.871e-1463.93Putative 60S ribosomal protein L32' OS=Mus musculu... [more]
RL32_MAIZE9.236e-1385.7160S ribosomal protein L32 (Fragment) OS=Zea mays G... [more]
RL32_DICDI9.236e-1359.0260S ribosomal protein L32 OS=Dictyostelium discoid... [more]
RL32B_SCHPO9.236e-1361.0260S ribosomal protein L32-B OS=Schizosaccharomyces... [more]
RL32A_SCHPO1.206e-1261.0260S ribosomal protein L32-A OS=Schizosaccharomyces... [more]
RL32_NEUCR3.510e-1256.9060S ribosomal protein L32 OS=Neurospora crassa GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900044 VSS Citrus sinensis cDNA clone VS27Q51 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900044 ID=DC900044|Name=DC900044|organism=Citrus sinensis|type=EST|length=488bp
TTCAAGGAAGTTTGTTGTGCACAATGTCAATGAACTGGAACTCTTGATGA
TGCACAACAGGACTTATTGTGCTGAGATAGCCCACAACGTATCAACCAAG
AAGAGAAAGGAGATTGTCGAGCGTGCTGCACAATTGGATGTTGTGGTCAC
CAACAAATTGGCCAGGTTGCGCAGCCAGGAGGAGGAGTAAAAATTGGTTT
CTATATTGTGTTAGTGTTTGCTTTTTGGCCAAATGTTTCCTAGGTTGTCT
TTGGAATGGATGAACATTTCCAGGGTTGAATTATGATGTATTTTCTATTT
TTGTCACCTGAATGATATTTTGAATTTGTTGTTTTTTGCGGAGCATGATT
AATGTTATGTCAACTTAGGAGTTAAGGTTTATGGCCAAGCCTTTTATTAA
CATTGTTTTGCATATTTTGCCGAAACTATTAGTGGGCAATGTTAAGCGTA
TGATGTTTAATAGCGTTAATTTGTTGACTGTTTCTATT
back to top