DC900036

Overview
NameDC900036
Unique NameDC900036
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900036_ssr1 microsatellite DC900036_ssr1:1..20. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6351 contig Csv1_Contig6351:103..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO3_BOVIN (Small ubiquitin-related modifier 3 OS=Bos taurus GN=SUMO3 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.280e-19
Identity = 49/90 (54.44%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SMO3L_DANRE (Small ubiquitin-related modifier 3-like OS=Danio rerio GN=sumo3l PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.280e-19
Identity = 49/90 (54.44%), Postives = 58/90 (64.44%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 327
            P+E  K  ND   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    6 PKEGVKTEND---HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_RAT (Small ubiquitin-related modifier 2 OS=Rattus norvegicus GN=Sumo2 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_PIG (Small ubiquitin-related modifier 2 OS=Sus scrofa GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_MOUSE (Small ubiquitin-related modifier 2 OS=Mus musculus GN=Sumo2 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_MACFA (Small ubiquitin-related modifier 2 OS=Macaca fascicularis GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_HUMAN (Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_CRIGR (Small ubiquitin-related modifier 2 OS=Cricetulus griseus GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_CHICK (Small ubiquitin-related modifier 2 OS=Gallus gallus GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
BLAST of DC900036 vs. ExPASy Swiss-Prot
Match: SUMO2_BOVIN (Small ubiquitin-related modifier 2 OS=Bos taurus GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 48/91 (52.75%), Postives = 59/91 (64.84%), Query Frame = 1
Query:   58 PQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGM 330
            P+E  K  N+   HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    6 PKEGVKTENND--HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV 94          
The following BLAST results are available for this feature:
BLAST of DC900036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SUMO3_BOVIN3.280e-1954.44Small ubiquitin-related modifier 3 OS=Bos taurus G... [more]
SMO3L_DANRE3.280e-1954.44Small ubiquitin-related modifier 3-like OS=Danio r... [more]
SUMO2_RAT7.307e-1952.75Small ubiquitin-related modifier 2 OS=Rattus norve... [more]
SUMO2_PIG7.307e-1952.75Small ubiquitin-related modifier 2 OS=Sus scrofa G... [more]
SUMO2_MOUSE7.307e-1952.75Small ubiquitin-related modifier 2 OS=Mus musculus... [more]
SUMO2_MACFA7.307e-1952.75Small ubiquitin-related modifier 2 OS=Macaca fasci... [more]
SUMO2_HUMAN7.307e-1952.75Small ubiquitin-related modifier 2 OS=Homo sapiens... [more]
SUMO2_CRIGR7.307e-1952.75Small ubiquitin-related modifier 2 OS=Cricetulus g... [more]
SUMO2_CHICK7.307e-1952.75Small ubiquitin-related modifier 2 OS=Gallus gallu... [more]
SUMO2_BOVIN7.307e-1952.75Small ubiquitin-related modifier 2 OS=Bos taurus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900036 VSS Citrus sinensis cDNA clone VS27Q44 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900036 ID=DC900036|Name=DC900036|organism=Citrus sinensis|type=EST|length=508bp
GAGAGAGAGAGAGAGAGAGACGAAGCAGAAGAGAGAATGTCAGGCGTCAC
GAACACTCCGCAAGAGGAAGATAAGAAGCCCAACGATCAATCGGCTCACA
TCAATCTCAAAGTCAAGGGCCAGGATGGGAATGAGGTTTTCTTCAGGATC
AAACGAAGCACCCAACTAAAGAAGCTTATGAATGCATACTGTGATAGACA
ATCTGTGGAGCTGAACTCAATTGCCTTCTTGTTTGATGGCCGCCGTCTTC
GAGGAGAGCAAACCCCTGATGAGCTGGAAATGGAAGATGGTGATGAGATT
GATGCCATGCTGCACCAAACCGGAGGAATGCTGATGTTCTAATTATGTAA
TGCTCGTTTGAGAGCTTATTAGTAGTATTAATGTAAAACTATTTATGGAT
GGATGTAAGTTATGCAGAGGCTCAAGATTGTGTATTTGTGATCTACACCA
TTATGTTTGGATTACCTAAGTATGTAGCTCTTTCTTCAAGAGCCCTGATC
GTTGCGGT
back to top