DC900035

Overview
NameDC900035
Unique NameDC900035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length436
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLT2A_ORYSJ (Non-specific lipid-transfer protein 2A OS=Oryza sativa subsp. japonica GN=LTP2-A PE=3 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.753e-13
Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            G + PS ACC+GV  L     TTADR+ AC C+K+ A    G+    A  +P +CGV I   I+P IDCS ++
Sbjct:   46 GGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN 118          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTPB_RICCO (Non-specific lipid-transfer protein B OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.504e-12
Identity = 33/72 (45.83%), Postives = 44/72 (61.11%), Query Frame = 3
Query:    6 EAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            +  PS  CC GV  LK   PT  D++ AC+C+K AA RY  I+ D A  LP +CGV I VPI+   +C +I+
Sbjct:   21 DTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCHEIN 92          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP_BETVU (Non-specific lipid-transfer protein OS=Beta vulgaris GN=IWF1' PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.965e-12
Identity = 31/72 (43.06%), Postives = 44/72 (61.11%), Query Frame = 3
Query:    3 GEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            G   PS ACC G++ L     + ADR+ AC C+K AAT  +GI   KA  LP++CGV +   I+P+ +C+ I
Sbjct:   45 GAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAI 116          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP_GERHY (Non-specific lipid-transfer protein OS=Gerbera hybrida PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.566e-12
Identity = 33/65 (50.77%), Postives = 39/65 (60.00%), Query Frame = 3
Query:   24 ACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            ACC GV  L +   TT DRQ AC C+K        I L+ A  LP +CG+ IG  ITP+IDCSKI
Sbjct:   51 ACCNGVRGLNNAAKTTPDRQTACGCLKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI 115          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLT41_HORVU (Non-specific lipid-transfer protein 4.1 OS=Hordeum vulgare GN=LTP4.1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.566e-12
Identity = 35/70 (50.00%), Postives = 44/70 (62.86%), Query Frame = 3
Query:    9 AKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            AKP  ACC+GV+ L     +TAD+QAACKCIK AA    G+   KA  +P  CGV +   I+  +DCSKI
Sbjct:   48 AKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAA---GGLNAGKAAGIPSMCGVSVPYAISASVDCSKI 114          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP2_SOLPN (Non-specific lipid-transfer protein 2 OS=Solanum pennellii GN=LTP2 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.351e-12
Identity = 32/68 (47.06%), Postives = 40/68 (58.82%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            P   CC GV+ L     TT DRQ AC C+K AA+ + G+ L KA  LP  C V+I   I+P  DCSK+
Sbjct:   46 PLGGCCGGVKGLLGQAQTTVDRQTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKV 113          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.351e-12
Identity = 34/68 (50.00%), Postives = 41/68 (60.29%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            P   CC GV+ L ++  TT DRQ AC C+K AA    GI L KA  LP  CGV+I   I+P  DCSK+
Sbjct:   46 PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKV 113          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLT43_HORVU (Non-specific lipid-transfer protein 4.3 OS=Hordeum vulgare GN=LTP4.3 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.377e-12
Identity = 35/70 (50.00%), Postives = 44/70 (62.86%), Query Frame = 3
Query:    9 AKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            AKP  ACC+GV+ L     +TAD+QAACKCIK AA    G+   KA  +P  CGV +   I+  +DCSKI
Sbjct:   48 AKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAA---GGLNAGKAAGIPSMCGVSVPYAISASVDCSKI 114          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLT42_HORVU (Non-specific lipid-transfer protein 4.2 OS=Hordeum vulgare GN=LTP4.2 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.377e-12
Identity = 35/70 (50.00%), Postives = 44/70 (62.86%), Query Frame = 3
Query:    9 AKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 218
            AKP  ACC+GV+ L     +TAD+QAACKCIK AA    G+   KA  +P  CGV +   I+  +DCSKI
Sbjct:   48 AKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAA---GGLNAGKAAGIPSMCGVSVPYAISASVDCSKI 114          
BLAST of DC900035 vs. ExPASy Swiss-Prot
Match: NLTP_MAIZE (Non-specific lipid-transfer protein OS=Zea mays PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.466e-12
Identity = 30/69 (43.48%), Postives = 42/69 (60.87%), Query Frame = 3
Query:   15 PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 221
            PS  CC+GV  L +   TTADR+AAC C+K+AA    G+    A  +P +CGV I   I+   DCS+++
Sbjct:   52 PSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN 120          
The following BLAST results are available for this feature:
BLAST of DC900035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
NLT2A_ORYSJ6.753e-1343.84Non-specific lipid-transfer protein 2A OS=Oryza sa... [more]
NLTPB_RICCO1.504e-1245.83Non-specific lipid-transfer protein B OS=Ricinus c... [more]
NLTP_BETVU1.965e-1243.06Non-specific lipid-transfer protein OS=Beta vulgar... [more]
NLTP_GERHY2.566e-1250.77Non-specific lipid-transfer protein OS=Gerbera hyb... [more]
NLT41_HORVU2.566e-1250.00Non-specific lipid-transfer protein 4.1 OS=Hordeum... [more]
NLTP2_SOLPN3.351e-1247.06Non-specific lipid-transfer protein 2 OS=Solanum p... [more]
NLTP1_TOBAC3.351e-1250.00Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLT43_HORVU4.377e-1250.00Non-specific lipid-transfer protein 4.3 OS=Hordeum... [more]
NLT42_HORVU4.377e-1250.00Non-specific lipid-transfer protein 4.2 OS=Hordeum... [more]
NLTP_MAIZE7.466e-1243.48Non-specific lipid-transfer protein OS=Zea mays PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900035 VSS Citrus sinensis cDNA clone VS27Q43 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900035 ID=DC900035|Name=DC900035|organism=Citrus sinensis|type=EST|length=436bp
CCGGGGAAGCCAAGCCATCTCGGGCATGCTGCACTGGTGTCGAGTATCTG
AAAGACAACACTCCAACAACTGCAGACAGGCAAGCTGCTTGTAAATGCAT
CAAAGATGCGGCAACTCGCTATCGCGGCATCAAGCTGGACAAAGCTCGTC
AACTCCCCAAAGAATGTGGCGTCGACATTGGCGTTCCCATCACCCCCGAT
ATCGACTGTAGCAAAATTTCTTAGAACCCCCCACGGAGGCTTTGAGCTTG
TGCGTTGAATAAACTTCTCTGCCTGGAGAAAACACAGCACAATTAGTACA
CATGATCTAATTATGCTTGTTAATTTATGCTGCTTGTTATGGTTCTTGCT
GAAGAACTTTTGTATCGGGATACTTATAGTGCATGGTGTTTTGGCACATA
ATTAGCGTTAATAAAACTACAGTTATTACCTCTACC
back to top