DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC1_COLGL (Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.747e-70
Identity = 117/147 (79.59%), Postives = 136/147 (92.52%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPP+SCSAGPV +D+FHWQATIMGP DSP++GGVF ++IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPD+PLVPEIAH+YKTDRA+YE TAR WT+KYA+
Sbjct:    1 MAFKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPGDSPYSGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDEPLVPEIAHVYKTDRARYEATAREWTRKYAI 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D4_HUMAN (Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.381e-69
Identity = 119/147 (80.95%), Postives = 129/147 (87.76%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI KEL DLQ+DPPA CSAGPV DD+FHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVPEIAH YK DR KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC4_YEAST (Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae GN=UBC4 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.356e-69
Identity = 115/146 (78.77%), Postives = 135/146 (92.47%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +SKRI KEL DL++DPP SCSAGPV DD++HWQA+IMGP+DSP+AGGVF +SIHFP DYPFKPPK++F TK++HPNIN+NG+ICLDILK+QWSPALT+SKVLLSICSLLTD NPDDPLVPEIAH+YKTDR KYE TAR WT+KYA+
Sbjct:    3 SSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 148          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D3_RAT (Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.077e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D3_PONAB (Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.077e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D3_MOUSE (Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.077e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D3_MACFA (Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.077e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D3_HUMAN (Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.077e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D2_XENLA (Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D2_RAT (Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC1_COLGL4.747e-7079.59Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletot... [more]
UB2D4_HUMAN1.381e-6980.95Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens... [more]
UBC4_YEAST2.356e-6978.77Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces... [more]
UB2D3_RAT3.077e-6980.95Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norve... [more]
UB2D3_PONAB3.077e-6980.95Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii... [more]
UB2D3_MOUSE3.077e-6980.95Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus... [more]
UB2D3_MACFA3.077e-6980.95Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fasci... [more]
UB2D3_HUMAN3.077e-6980.95Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens... [more]
UB2D2_XENLA4.019e-6980.95Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laev... [more]
UB2D2_RAT4.019e-6980.95Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norve... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top