DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D2_MOUSE (Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D2_HUMAN (Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D2_BOVIN (Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 119/147 (80.95%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBCD1_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.169e-68
Identity = 118/147 (80.27%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL+DL +DPPA CSAGPV DD+FHWQATIMGP DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   AR WT+KYAM
Sbjct:    1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D2_PIG (Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.169e-68
Identity = 118/147 (80.27%), Postives = 130/147 (88.44%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI+KEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2D3_BOVIN (Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.994e-68
Identity = 118/147 (80.27%), Postives = 129/147 (87.76%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRINKEL DL +DPPA CSAGPV DDMFHWQATIMGP+DSP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSN SICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNDSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC5_YEAST (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae GN=UBC5 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.402e-68
Identity = 116/146 (79.45%), Postives = 134/146 (91.78%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +SKRI KEL DL +DPPASCSAGPV DD++HWQA+IMGPSDSP+AGGVF +SIHFP DYPFKPPKV F TK++HPNINS+G+ICLDILK+QWSPALT+SKVLLSICSLLTD NPDDPLVPEIA +YKTD+AKYE TA+ WT+KYA+
Sbjct:    3 SSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV 148          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC4_CANAL (Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.443e-68
Identity = 115/147 (78.23%), Postives = 132/147 (89.80%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            M+ KRINKEL DL +DPP+SCSAGPV DD++HWQA+IMGP DSP+AGGVF +SIHFP DYP KPPK+A  TK++HPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTD NPDDPLVPEIAH+YK DR KYE TA+ WT+KYA+
Sbjct:    1 MSLKRINKELSDLGRDPPSSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPLKPPKIALTTKIYHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_CAEEL (Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.293e-67
Identity = 116/147 (78.91%), Postives = 129/147 (87.76%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            MA KRI KEL+DL +DPPA CSAGPV DD+FHWQATIMGP +SP+ GGVF ++IHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YKTDR +Y   AR WTQKYAM
Sbjct:    1 MALKRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYAM 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC12_ARATH (Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.380e-67
Identity = 117/149 (78.52%), Postives = 136/149 (91.28%), Query Frame = 2
Query:   47 MASKRINKELKDLQKDPPASCSAGPVAD-DMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 490
            MASKRI++EL+D+Q+ PPA+CSAGPVA+ D+FHWQATIMGP DSP++GGVF VSI F  DYPFKPPKV F+TKV+HPNI+S GSICLDILKEQWSPA T SKVLLSICSLLTDPNP+DPLVPEIAH+YK D++KYE+TA+ WTQKYAMG
Sbjct:    1 MASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYKVDKSKYESTAQKWTQKYAMG 149          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2D2_MOUSE4.019e-6980.95Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus... [more]
UB2D2_HUMAN4.019e-6980.95Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens... [more]
UB2D2_BOVIN4.019e-6980.95Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus G... [more]
UBCD1_DROME1.169e-6880.27Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UB2D2_PIG1.169e-6880.27Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa G... [more]
UB2D3_BOVIN1.994e-6880.27Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus G... [more]
UBC5_YEAST3.402e-6879.45Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharo... [more]
UBC4_CANAL4.443e-6878.23Ubiquitin-conjugating enzyme E2 4 OS=Candida albic... [more]
UBC2_CAEEL1.293e-6778.91Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditi... [more]
UBC12_ARATH8.380e-6778.52Probable ubiquitin-conjugating enzyme E2 12 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top