DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC6_DEBHA (Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces hansenii GN=UBC6 PE=3 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.027e-12
Identity = 37/116 (31.90%), Postives = 61/116 (52.59%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLT 379
            S+ + KR+ KE K +  +PP   SA P  +++  W   I GP  +PF  G +   + FP +YPFKPP ++  T   +     N  +CL   D   + W+PA +++ +L  + S +T
Sbjct:    3 SRQSQKRLTKEYKAITLNPPPYVSAKPNDENILEWHYVITGPPHTPFEEGQYHGILRFPSEYPFKPPSISMITP--NGRFACNTRLCLSMSDYHPDTWNPAWSVATILTGLLSFMT 116          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: Y1A1_ENCCU (Probable ubiquitin-conjugating enzyme E2 ECU01_1010 OS=Encephalitozoon cuniculi GN=ECU01_1010 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.898e-12
Identity = 35/116 (30.17%), Postives = 57/116 (49.14%), Query Frame = 2
Query:  143 WQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL--------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY 448
            W        DS +AG +    + FP  YP +PP + F +K+FHPNI  +G +C+ IL              K++W+P   I  +++SI  +L  PN   P   + + MY+ +  +Y
Sbjct:   68 WDIYFTLGGDSLYAGRILKAVMKFPSSYPLRPPTLKFVSKMFHPNIYEDGKMCISILEEDKQQDSSVFGDPKDKWTPVQNIRTIVMSIVVILNSPNISSPANVDASVMYRDNPEEY 183          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC17_CAEEL (Probable ubiquitin-conjugating enzyme protein 17 OS=Caenorhabditis elegans GN=ubc-17 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 7.703e-12
Identity = 47/120 (39.17%), Postives = 66/120 (55.00%), Query Frame = 2
Query:   53 SKRINKELKDLQKDPP--ASCSAGPVADD--MFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTK-----VFHPNINSNGSICLDIL-------KEQWSPALTISKVLLSI 364
            +KRI KEL  +    P  AS S     D+  +   +  I GP D+P+A G+F   I FP  YPF PPK AF T       F+PN+ ++G ICL IL       +E+W+P  ++ +VL+SI
Sbjct:  411 TKRIAKELASIANALPLNASNSIYVCYDEGRVDIIKVLISGPDDTPYANGLFEFDIFFPTGYPFSPPKCAFLTTGSGNVRFNPNLYNDGKICLSILGTWEGRPEEKWNPYCSLMQVLVSI 530          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC12_CAEEL (NEDD8-conjugating enzyme ubc-12 OS=Caenorhabditis elegans GN=ubc-12 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.314e-11
Identity = 39/113 (34.51%), Postives = 58/113 (51.33%), Query Frame = 2
Query:  164 PSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ------WSPALTISKVLLSICSLLTD-PNPDDPLVPEIAHMYKTDRAKYETTARSWTQKY 481
            P +  + GG F   I  PP+Y   PP V   TKV+HPNIN +GSICL IL++       W P   ++ V+  + SL  D  + +D L  + A M+  +R  +    R +  +Y
Sbjct:   67 PQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNINEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNRESFNHRVREYISRY 179          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2J2_MOUSE (Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus GN=Ube2j2 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.993e-11
Identity = 32/117 (27.35%), Postives = 60/117 (51.28%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNP 391
            A++R+ ++   ++KDP     A P+  ++  W   + GP  +P+ GG +   + FP ++PFKPP +   T   +     N  +CL   D   + W+PA ++S +L  + S + +  P
Sbjct:   13 ATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2J2_HUMAN (Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens GN=UBE2J2 PE=1 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 4.993e-11
Identity = 32/117 (27.35%), Postives = 60/117 (51.28%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNP 391
            A++R+ ++   ++KDP     A P+  ++  W   + GP  +P+ GG +   + FP ++PFKPP +   T   +     N  +CL   D   + W+PA ++S +L  + S + +  P
Sbjct:   13 ATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2J2_BOVIN (Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus GN=UBE2J2 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.993e-11
Identity = 32/117 (27.35%), Postives = 60/117 (51.28%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNP 391
            A++R+ ++   ++KDP     A P+  ++  W   + GP  +P+ GG +   + FP ++PFKPP +   T   +     N  +CL   D   + W+PA ++S +L  + S + +  P
Sbjct:   13 ATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC6_DEBHA2.027e-1231.90Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces ... [more]
Y1A1_ENCCU5.898e-1230.17Probable ubiquitin-conjugating enzyme E2 ECU01_101... [more]
UBC17_CAEEL7.703e-1239.17Probable ubiquitin-conjugating enzyme protein 17 O... [more]
UBC12_CAEEL1.314e-1134.51NEDD8-conjugating enzyme ubc-12 OS=Caenorhabditis ... [more]
UB2J2_MOUSE4.993e-1127.35Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus... [more]
UB2J2_HUMAN4.993e-1127.35Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens... [more]
UB2J2_BOVIN4.993e-1127.35Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top