DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E3_MOUSE (Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus GN=Ube2e3 PE=1 SV=2)

HSP 1 Score: 196.052 bits (497), Expect = 1.588e-49
Identity = 90/145 (62.07%), Postives = 113/145 (77.93%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            ++KRI KEL ++  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E3_HUMAN (Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens GN=UBE2E3 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.588e-49
Identity = 90/145 (62.07%), Postives = 113/145 (77.93%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            ++KRI KEL ++  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UB2E3_BOVIN (Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus GN=UBE2E3 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.588e-49
Identity = 90/145 (62.07%), Postives = 113/145 (77.93%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            ++KRI KEL ++  DPP +CSAGP  D+++ W++TI+GP  S + GGVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y T+RA+++  AR WT++YA
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: COP10_ARATH (Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana GN=COP10 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.329e-42
Identity = 71/145 (48.97%), Postives = 106/145 (73.10%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            + KRI +E+ +L  DPP  CSAGP  D+++HW ATI+GPS +P+ GG+F + I FP DYPFKPPK+ F+T+++H N+++ G + ++IL++ WSPALTI+KVL +I S+   P P  P +P IA +Y TDR K++  A+ WT ++A
Sbjct:   37 SGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFA 181          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBCB_DICDI (Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum GN=ubcB PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.392e-39
Identity = 77/146 (52.74%), Postives = 100/146 (68.49%), Query Frame = 2
Query:   50 ASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            A KR+ KE+ D+ K PP+ CSA  V D++  W+AT+ GP  SPF  GVF + I  P DYPFKPP + F TK++HPNI  S+G+IC ++    WSP L I  VL +I S+LTDPNPD+PL  EIA  +KTDR  +  TA+ WT+KYA
Sbjct:    3 AHKRLQKEITDMLKTPPSWCSAHLVDDNLQKWKATVQGPEGSPFEKGVFSMDIDIPADYPFKPPTLKFTTKIYHPNIKTSDGAICAEVFST-WSPQLKILDVLTTIRSILTDPNPDNPLETEIAQQFKTDRNAFNKTAKEWTKKYA 147          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC31_ARATH (Probable ubiquitin carrier protein E2 31 OS=Arabidopsis thaliana GN=UBC31 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 9.036e-37
Identity = 66/125 (52.80%), Postives = 93/125 (74.40%), Query Frame = 2
Query:  110 SAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            S G  +++++ W A I GP  +P+ GG+F +SI FP DYPFKPPK  F+T ++HPNIN  GSIC++ILK++W+PAL + KVLLSI  LL  PNPDDPLVPEI  ++K +R +++  AR +T ++A
Sbjct:   28 SIGQNSNNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMNILKDKWTPALMVEKVLLSILLLLEKPNPDDPLVPEIGQLFKNNRFQFDQRAREFTARHA 152          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC35_ARATH (Ubiquitin carrier protein E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.704e-35
Identity = 72/145 (49.66%), Postives = 97/145 (66.90%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 490
            +RI KE + L  +P    SA P  D+M ++   I+GP+ SP+ GGVF + +  P +YP   PKV F TK++HPNI+  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL   IA  +K++ A+   TA+ WT+ YA G
Sbjct:    8 RRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVDTAKEWTRLYASG 152          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_DROME (Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.226e-35
Identity = 69/144 (47.92%), Postives = 98/144 (68.06%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L ++P    +A P  ++  ++   + GP+DSPF GGVF + +  P DYP   PKV F TK++HPNI+  G ICLD+LK++WSPAL I  +LLSI +LL+ PNPDDPL  ++A ++K + A+    AR WTQKYA+
Sbjct:    6 RRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYAV 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC14_SCHPO (Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccharomyces pombe GN=ubc14 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.907e-35
Identity = 67/149 (44.97%), Postives = 98/149 (65.77%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ-WSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 484
            S  +S+R+ KE  DL++ P        V D++FHW  T +GPSDS +AGG F  S+ FP DYPF+PP + F T+++HPN +S G++CL ILK+Q + P++ +  VL  I  LL +PNPDDPLV  IA  Y+ DR  ++  AR + +++A
Sbjct:    5 SPSSSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQPPTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYRNDRPSFDKIARDYVEQFA 153          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2N_MACFA (Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.797e-35
Identity = 70/144 (48.61%), Postives = 95/144 (65.97%), Query Frame = 2
Query:   56 KRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            +RI KE + L  +P     A P   +  ++   I GP DSPF GG F + +  P +YP   PKV F TK++HPN++ +G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KT+ A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKSGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2E3_MOUSE1.588e-4962.07Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus... [more]
UB2E3_HUMAN1.588e-4962.07Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens... [more]
UB2E3_BOVIN1.588e-4962.07Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus G... [more]
COP10_ARATH9.329e-4248.97Constitutive photomorphogenesis protein 10 OS=Arab... [more]
UBCB_DICDI7.392e-3952.74Ubiquitin conjugating enzyme E2 B OS=Dictyostelium... [more]
UBC31_ARATH9.036e-3752.80Probable ubiquitin carrier protein E2 31 OS=Arabid... [more]
UBC35_ARATH1.704e-3549.66Ubiquitin carrier protein E2 35 OS=Arabidopsis tha... [more]
UBE2N_DROME2.226e-3547.92Ubiquitin-conjugating enzyme E2 N OS=Drosophila me... [more]
UBC14_SCHPO2.907e-3544.97Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccha... [more]
UBE2N_MACFA3.797e-3548.61Ubiquitin-conjugating enzyme E2 N OS=Macaca fascic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top