DC900030

Overview
NameDC900030
Unique NameDC900030
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:168..869. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2B_MOUSE (Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPP   S  P  +++  W A I GP  +PF  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2B_HUMAN (Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPP   S  P  +++  W A I GP  +PF  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2B_BOVIN (Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.326e-31
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE 451
            S  A +R+ ++ K LQ+DPP   S  P  +++  W A I GP  +PF  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ ++ +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBE2T_XENLA (Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.344e-31
Identity = 67/147 (45.58%), Postives = 96/147 (65.31%), Query Frame = 2
Query:   59 RINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 487
            R+ +EL+ L K+PP          +M   +A I+G S SP+ GG+F + I  P  YPF+PPK+ F T ++HPNI+S G ICLDIL    K  W PAL IS VL SI  L+++PNPDDPL+ +I+  +K +RA + + A+ WT+K+A+
Sbjct:    6 RLKRELQLLNKEPPPGVICWQNESNMDDLRAQIIGGSGSPYEGGIFNLEIIVPERYPFEPPKIRFLTPIYHPNIDSAGRICLDILKLPPKGAWRPALNISTVLTSIQLLMSEPNPDDPLMADISSEFKYNRAVFFSNAKKWTEKHAL 152          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_USTMA (Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.673e-31
Identity = 63/148 (42.57%), Postives = 88/148 (59.46%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  + KR+ ++ K L  DPP   S  P AD++  W A I GP+D+PF  G F + + F   YP KPP V F +K+FHPN+ +NG +CLDIL+ +WSP   ++ +L SI SLL DPNP+ P   E A +Y+ +  +Y      T   SW
Sbjct:    2 STPSKKRLIRDFKRLSTDPPGGISGAPCADNLMIWNAVIFGPADTPFEDGTFKLVLTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLHDPNPNSPANAEAASLYRENMKEYVRRVKATVEASW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_DICDI (Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 5.673e-31
Identity = 64/149 (42.95%), Postives = 93/149 (62.42%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSWT 472
            S  A +R+ ++ K LQ DPPA  S  P+ +++  WQA I GP DS + G  F +S+ F  +YP   P V F +K+FHPN+ ++GSICLDIL+ QWSP   I+ +L SI SLL DPNP+ P   E A +++ ++ +Y     E   +SW+
Sbjct:    2 STAARRRLMRDFKRLQSDPPAGISGAPLENNILMWQAVIFGPDDSIWEGATFKLSLQFSEEYPNDAPTVKFLSKMFHPNVYADGSICLDILQNQWSPIYDIAAILTSIQSLLCDPNPNSPANSESARLFRENKREYNRKVKEIVEQSWS 150          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_SCHPO (Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe GN=rhp6 PE=1 SV=3)

HSP 1 Score: 134.035 bits (336), Expect = 7.409e-31
Identity = 62/148 (41.89%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +Q+DPPA  SA PV+D++  W A I+GP+D+PF  G F + + F   YP KPP V F + +FHPN+ +NG +CLDIL+ +WSP   ++ +L SI SLL DPN   P   E A +++ ++ +Y     +T   SW
Sbjct:    2 STTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_CANGA (Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata GN=UBC2 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.264e-30
Identity = 60/148 (40.54%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +++D P   SA P+ D++  W A I+GP+D+P+  G F + + F  DYP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A ++K  +++Y     ET  +SW
Sbjct:    2 STPARRRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_YEAST (Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae GN=RAD6 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.677e-30
Identity = 59/148 (39.86%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +++D P   SA P+ D++  W A I+GP+D+P+  G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A ++K  +++Y     ET  +SW
Sbjct:    2 STPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSW 149          
BLAST of DC900030 vs. ExPASy Swiss-Prot
Match: UBC2_ASHGO (Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.677e-30
Identity = 59/148 (39.86%), Postives = 93/148 (62.84%), Query Frame = 2
Query:   41 SQMASKRINKELKDLQKDPPASCSAGPVADDMFHWQATIMGPSDSPFAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKY-----ETTARSW 469
            S  A +R+ ++ K +++D P   SA P+ D++  W A I+GP+D+P+  G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A ++K  +++Y     ET  +SW
Sbjct:    2 STPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSW 149          
The following BLAST results are available for this feature:
BLAST of DC900030 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBE2B_MOUSE3.326e-3143.80Ubiquitin-conjugating enzyme E2 B OS=Mus musculus ... [more]
UBE2B_HUMAN3.326e-3143.80Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens ... [more]
UBE2B_BOVIN3.326e-3143.80Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN... [more]
UBE2T_XENLA4.344e-3145.58Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevi... [more]
UBC2_USTMA5.673e-3142.57Ubiquitin-conjugating enzyme E2 2 OS=Ustilago mayd... [more]
UBC2_DICDI5.673e-3142.95Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium... [more]
UBC2_SCHPO7.409e-3141.89Ubiquitin-conjugating enzyme E2 2 OS=Schizosacchar... [more]
UBC2_CANGA1.264e-3040.54Ubiquitin-conjugating enzyme E2 2 OS=Candida glabr... [more]
UBC2_YEAST3.677e-3039.86Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces... [more]
UBC2_ASHGO3.677e-3039.86Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossyp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900030 VSS Citrus sinensis cDNA clone VS27Q38 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900030 ID=DC900030|Name=DC900030|organism=Citrus sinensis|type=EST|length=703bp
AGCCAGACCCAACTCTCAGGCCCCAAAGTTGTTGAGAAATTCCCAGATGG
CTTCAAAACGGATCAACAAGGAGTTGAAGGATCTACAGAAGGACCCTCCT
GCTTCTTGTAGCGCTGGCCCTGTTGCTGATGACATGTTCCATTGGCAAGC
AACAATTATGGGCCCATCAGACAGCCCATTTGCTGGGGGTGTATTTCTTG
TATCCATTCATTTCCCACCTGATTATCCATTCAAGCCACCGAAGGTGGCC
TTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCAATGGTAGCATCTG
TCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTGACAATATCCAAGG
TACTTCTGTCAATTTGCTCACTACTTACTGATCCGAACCCAGATGACCCA
CTTGTGCCTGAGATTGCTCACATGTACAAGACTGACAGAGCCAAATATGA
GACTACTGCTCGATCCTGGACTCAGAAGTATGCCATGGGTTAAGAGGGGC
TAGGCTGTATGCCCCTGAGAACATTAATGGCTTGTGGTCCTATTAGTAAA
TAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGATATTTGGTTTTGT
TTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTTTCAAATTTAGCAT
TGTTCTTCAATACTTAAATTATAATTTACTGCAGAATTGAGCTGCCTTTG
CCT
back to top