DC900028

Overview
NameDC900028
Unique NameDC900028
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4378 contig Csv1_Contig4378:57..772. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: SSRP1_MOUSE (FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.336e-11
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTK 434
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK MS+  K  +  KAE  + EYEK MK Y   + + +K
Sbjct:  543 DPNAPKRPMSAYMLWLNASREKIKSDHP-GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARREYEKAMKEYEGGRGDSSK 623          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: SSRP1_HUMAN (FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.336e-11
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTK 434
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK MS+  K  +  KAE  + +YEK MK Y   + E +K
Sbjct:  543 DPNAPKRPMSAYMLWLNASREKIKSDHP-GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSK 623          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMG3M_HUMAN (Putative high mobility group protein B3-like protein OS=Homo sapiens PE=5 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.278e-11
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNY-NRRQAEGTK 434
            DPN PKRP S FF+F  EF  + K  +P    +  V K  GE WK++++++K PY+ +A K K +YEKD+  Y ++ +++G K
Sbjct:   88 DPNAPKRPPSGFFLFCSEFCPKSKSTNP-GIPIGDVAKKLGEMWKNLNDSEKQPYITQAAKLKEKYEKDVAVYKSKGKSDGAK 169          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: SSRP1_CHICK (FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.976e-11
Identity = 34/74 (45.95%), Postives = 46/74 (62.16%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYN 410
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK+MS+  K  +  KAE  K +YEK MK Y+
Sbjct:  541 DPNAPKRPMSAYMLWLNANREKIKSDHP-GISITDLSKKAGELWKAMSKEKKEEWDRKAEDAKRDYEKAMKEYS 613          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMG3L_HUMAN (High mobility group protein B3-like-1 OS=Homo sapiens GN=HMGB3L1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.976e-11
Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNY-NRRQAEGTK 434
            DPN PKRP S FF+F  EF  + K  +P   S+  V K  GE W ++++++K PYV K  K K +YEKD+ +Y ++ + +GTK
Sbjct:   25 DPNAPKRPLSGFFLFCSEFCPKIKSTNP-GISIGDVAKKLGEMWNNLNDSEKQPYVTKVAKLK-KYEKDVADYKSKGKLDGTK 105          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: NHP6_GIBZE (Non-histone chromosomal protein 6 OS=Gibberella zeae GN=NHP6 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.076e-11
Identity = 35/79 (44.30%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAE 425
            DPN PKR  SA+  F  E RE  ++++P   S   VGK  GE+WK+++E  +APY AKA   K  YE + + YN  Q E
Sbjct:   20 DPNAPKRGLSAYMFFANEQRENVREENP-GISFGQVGKLLGERWKALNEKQRAPYEAKAAADKKRYEDEKQAYNADQEE 97          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HMGLX_HUMAN (High mobility group protein 1-like 10 OS=Homo sapiens GN=HMG1L10 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.629e-11
Identity = 34/76 (44.74%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR 416
            DPN PKR  SAFF+F   +R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRTPSAFFLFCSAYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of DC900028 vs. ExPASy Swiss-Prot
Match: HGB1A_HUMAN (Putative high mobility group protein B1-like 1 OS=Homo sapiens GN=HMGB1L1 PE=5 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.629e-11
Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = 3
Query:  189 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEG 428
            DPN PKRP SAFF+F  E+  + K +HP   S+  V K  GE W + +  DK P   KA K K +YEKD+  Y   QA+G
Sbjct:   91 DPNAPKRPPSAFFLFCSEYHPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPGEKKAAKLKEKYEKDIAAY---QAKG 166          
The following BLAST results are available for this feature:
BLAST of DC900028 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
SSRP1_MOUSE1.336e-1142.68FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp... [more]
SSRP1_HUMAN1.336e-1142.68FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP... [more]
HMG3M_HUMAN2.278e-1140.96Putative high mobility group protein B3-like prote... [more]
SSRP1_CHICK2.976e-1145.95FACT complex subunit SSRP1 OS=Gallus gallus GN=SSR... [more]
HMG3L_HUMAN2.976e-1143.37High mobility group protein B3-like-1 OS=Homo sapi... [more]
NHP6_GIBZE5.076e-1144.30Non-histone chromosomal protein 6 OS=Gibberella ze... [more]
HMGLX_HUMAN6.629e-1144.74High mobility group protein 1-like 10 OS=Homo sapi... [more]
HGB1A_HUMAN6.629e-1146.25Putative high mobility group protein B1-like 1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900028 VSS Citrus sinensis cDNA clone VS27Q36 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900028 ID=DC900028|Name=DC900028|organism=Citrus sinensis|type=EST|length=712bp
TCTGCGTCTCTCTCTTTTTCTCTTTCCTCTTTTTCTCTCATTTGAAGCCC
TAACCCTAGCTCTATCTTTCTTCAGAAACAGGATTTGAAATGAAAGGAGG
TAAATCAAAGTCAGATACCAGAAACGCCAAGCTCTCTGTGAACAAGAAGC
CTGCCAAAGCTGGACGAAAATCGGGAAAGGCAGCTAAGGACCCGAACAAG
CCAAAGAGGCCAGCCAGCGCCTTCTTTGTTTTCATGGAAGAATTCCGTGA
ACAATACAAGAAGGATCATCCTAAGAACAAATCAGTTGCTGCTGTTGGTA
AAGCTGGTGGTGAGAAATGGAAGTCAATGTCTGAAGCTGATAAAGCACCG
TATGTTGCTAAGGCAGAGAAGCGCAAGGTTGAGTATGAGAAGGATATGAA
AAACTACAATAGGAGACAGGCGGAGGGAACTAAGCCGGAGGAAGAAGAGG
AGTCTGAGAAGTCTATGTCAGAGGTGAATGATGAGGATGATGATGAAGAA
GGCAGTGGCGAGGAGGATGATGATGAATAGAAGTTGAAGGAAGAAATTAG
CATAGTCATGTTAGGCTGTGACAATGTTTCAAACAACATATGTTAATGCT
TGNGCTTCCATGTTAATTTTTTGGATGCTTTCATCATCTTCATCATCATG
TAGAGATCATGTTGCTTCTNCCTCGACATTTTCTTATGCCTGCCTTTCAA
GAATAATAGCTG
back to top