DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: ERL1_ARATH (LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.498e-21
Identity = 71/202 (35.15%), Postives = 103/202 (50.99%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGS-KECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP ELG+   L +L LN N   G+IPP L K        +A N +VG     I +  +  + +  GNLL  +G        + + +  N +   + G       H  ++  LD+S N  SGSIP  +G + +L ILNL  N+LSG +P E G+LR + ++D+S N L G IP+ +  L  LN + L  N+L G IP
Sbjct:  320 NMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANNRLVGPIPSNISSCAALNQFNVHGNLL--SGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKIP 519          

HSP 2 Score: 88.1965 bits (217), Expect = 3.342e-17
Identity = 71/247 (28.74%), Postives = 107/247 (43.32%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKN-DGSKECHGAGN--------------LLEFAGIRAERLSRISTRSPCNFTRVY---------GGHTQPTFNHNGSMMFLDISYNM-----------------------LSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G+IP E+G+C SL++LDL+ NL  G IP ++ K    ++  +  N + G     +      K    AGN              +L++ G+R   L+   +   C  T ++          G    +  +  S   LDISYN                        L+G IP+ IG M  L +L+L  N L GPIP  +G+L     L L  N L G IPS + +++ L+ + L  N+L G IP
Sbjct:  105 NKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLYWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITGEIPYNIGFLQVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIP 351          

HSP 3 Score: 73.559 bits (179), Expect = 8.517e-13
Identity = 58/206 (28.16%), Postives = 86/206 (41.75%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVY---------GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN   G +P  L    +L  LDL  N   G I   L+                                +L++ G+R   L+   +   C  T ++          G    +  +  S   LDISYN ++G IP  IG +  +  L+L  N L+G IP  +G ++ L +LDLS N L G IP  + +L+   ++ L  N LTG IP
Sbjct:  152 NNQLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLY-----------------------------WNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITGEIPYNIGFLQ-VATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNMLTGPIP 327          

HSP 4 Score: 71.633 bits (174), Expect = 3.237e-12
Identity = 36/100 (36.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query:  290 GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            GG   P      ++  +D+  N L+G IP EIG+ + L  L+L  N L G IP  +  L+ L  L+L +N+L G +P++++ +  L  +DL  N LTG I
Sbjct:   84 GGEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI 183          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RCH1_ARATH (LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.449e-20
Identity = 71/213 (33.33%), Postives = 107/213 (50.23%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGA-----GNL--LEFAGIRAERLSRI---------STRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G+IPPELGDC SL  L++  N  + ++P  L    GKI+           I+  G+ E  G      GN   L+  G+ A ++S             +S   ++ +  G       +   ++ L +  N LSG++PKE+G +  L  + L  NNL GPIP E+G ++ LN +DLS N   GTIP S  +L+ L E+ L +N +TG IP
Sbjct:  163 SNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPLEL----GKIST-------LESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQLSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIP 364          

HSP 2 Score: 90.5077 bits (223), Expect = 6.733e-18
Identity = 64/207 (30.92%), Postives = 100/207 (48.31%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPP--ALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEF--------AGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N+  G IP  L +C  L+   ++ N  +G IPP   L K+      N  +G +   ++ +   E  G  NL             + A      +       +    G       +  S++ L +  N ++G IPK IG +  L  L+L  NNLSGP+P E+ + R L +L+LS+N L+G +P S+SSLT L  +D+ +N LTG IP
Sbjct:  356 SNNITGSIPSILSNCTKLVQFQIDANQISGLIPPEIGLLKE-----LNIFLGWQNK-LEGNIPDELAGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLISNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTGKIP 556          

HSP 3 Score: 77.0258 bits (188), Expect = 7.704e-14
Identity = 58/198 (29.29%), Postives = 92/198 (46.46%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLN-EIDLGTNQLTGMIP 592
            +N+  G IP E+G+C SL+ L L  N   G IP  +          F+    ++    D S+        LE +  R  ++  +S  +         G+   + +    +  LD+S N L+G IP  +G +  L  L L  N+ +G IP+ +G    L +LDLSSN + GTIP  +  +  L+  ++L  N L G IP
Sbjct:  452 SNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGI---------GFLQNLSFL----DLSENNLSGPVPLEISNCRQLQMLNLSNNT-------LQGYLPLSLSSLTKLQVLDVSSNDLTGKIPDSLGHLISLNRLILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISGTIPEELFDIQDLDIALNLSWNSLDGFIP 629          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PEPR1_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.893e-20
Identity = 68/197 (34.52%), Postives = 97/197 (49.24%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNSFYG IPP LG   SL  +D   N   G IPP           N   G+K + I N GS   HG    +  +    + + R   R   N + +      P F+ + S+ FLD + N   G IP  +GS   L  +NL  N  +G IP ++G+L+ L  ++LS N LEG++P+ +S+   L   D+G N L G +P
Sbjct:  420 NNSFYGAIPPGLGVNSSLEEVDFIGNKLTGEIPP-----------NLCHGRK-LRILNLGSNLLHGT---IPASIGHCKTIRRFILREN-NLSGLL-----PEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVP 595          

HSP 2 Score: 90.1225 bits (222), Expect = 8.794e-18
Identity = 64/205 (31.22%), Postives = 98/205 (47.80%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGN-----LLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G IP  +GD + L+ L +  N F+G+IP ++   S      +  N +VG     +   G+      GN      + F     + L  +      ++    GG   P   +  S+  L I    LSG+IP  +G +  L ILNL  N LSG IP E+G+   LN+L L+ N+L G IPS++  L  L  ++L  N+ +G IP
Sbjct:  181 NNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLD----LSYNEFEGG-VPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIP 380          

HSP 3 Score: 76.2554 bits (186), Expect = 1.314e-13
Identity = 58/201 (28.86%), Postives = 87/201 (43.28%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNI-LDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            +N+F G IP  LG C++L  ++L+ N F G IPP L          ++ N + G     + N  S E    G             + ++   P NF+   G  T            L +S N  SG IP+ +  +  L  L +  N   G IP+ +G +  L   LDLS N L G IP+ +  L  L  +++  N LTG +
Sbjct:  515 SNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVG------------FNSLNGSVPSNFSNWKGLTT------------LVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIPSSIGLIEDLIYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL 691          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.472e-20
Identity = 72/208 (34.62%), Postives = 103/208 (49.52%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKND-------GSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G+IPP++  C  L  L L  NL  GSIP  L K SG    +I  N  +  +      D       G  E   +GNL    G    +L ++ T S   +T +  G       +   ++ L +  N LSGSIP+EIG ++ L  L L  N+L G IP E+G+   L ++DLS N L G+IPSS+  L+ L E  +  N+ +G IP
Sbjct:  162 SNQLTGKIPPDISKCSKLKSLILFDNLLTGSIPTELGKLSGLEVIRIGGNKEISGQIPSEIGDCSNLTVLGLAETSVSGNLPSSLG----KLKKLETLSI--YTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIP 363          

HSP 2 Score: 95.5153 bits (236), Expect = 2.093e-19
Identity = 69/203 (33.99%), Postives = 95/203 (46.80%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNL-LEFAGIRAERLSRISTRSPCNF-----TRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IPP L DC  L  LDL+ N   G+IP  LF          I      +I  +    C     L L F  I  E  S I +    NF      R++G            +  +D+S N L GS+P  + S+S L +L++  N  SG IP  +G L  LN L LS N   G+IP+S+   + L  +DLG+N+L+G IP
Sbjct:  403 SNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGFIPQEIGN-CSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNRLHG-KVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIP 603          

HSP 3 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 57/203 (28.08%), Postives = 98/203 (48.28%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTR-VYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFI-LNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N  +G++P E+G C  L  +DL+ N   GS+P  +   SG     ++AN                         +F+G     L R+ + +    ++ ++ G    +      +  LD+  N LSG IP E+G +  L I LNL  N L+G IP+++  L  L+ILDLS N LEG + + ++++  L  +++  N  +G +P
Sbjct:  499 SNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSAN-------------------------QFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIPSKIASLNKLSILDLSHNMLEGDL-APLANIENLVSLNISYNSFSGYLP 675          

HSP 4 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 60/196 (30.61%), Postives = 87/196 (44.39%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NS  G IP E+G+C +L  +DL+ NL +GSIP ++                             G  + LE   I   + S               G    T ++  S++ L +  N +SG IP E+G+++ L +     N L G IP  + D   L  LDLS N L GTIPS +  L  L ++ L +N L+G IP
Sbjct:  308 NSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSI-----------------------------GRLSFLEEFMISDNKFS---------------GSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGFIP 459          

HSP 5 Score: 69.707 bits (169), Expect = 1.230e-11
Identity = 44/110 (40.00%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  263 SPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +PCN        T  T +  G +  +DI    L  S+PK + +   L  L +   NL+G +P  +GD  GL +LDLSSN L G IP S+S L  L  + L +NQLTG IP
Sbjct:   67 TPCN------NWTFITCSSQGFITDIDIESVPLQLSLPKNLPAFRSLQKLTISGANLTGTLPESLGDCLGLKVLDLSSNGLVGDIPWSLSKLRNLETLILNSNQLTGKIP 170          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y4265_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.663e-19
Identity = 68/200 (34.00%), Postives = 100/200 (50.00%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G+IP ELG+C  L  +D + NL  G+IP +  K    Q  +++ N I G     + N          N L    I +   +  S      +     G+   + +    +  +D+SYN LSGSIPKEI  +  L  L L  N+LSG IP ++G+   L  L L+ NRL G+IPS + +L  LN +D+  N+L G IP
Sbjct:  296 NNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIP 495          

HSP 2 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 74/226 (32.74%), Postives = 96/226 (42.48%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALF-------------KQSGKIAANFIVGKKYVYIKNDGSKECHGA-----GNL--LEFAGIRAERLSRISTRSPCNFTRVY---------GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +NS  G IP E+   + L  L LNTN   G IP  +              K SG+I  +    K    ++  G+K   G      GN   L   G+    LS     S  N  RV           G       +   +  L +  N +SGSIP  IG +  L  L L  NNL G IPTE+G+   L ++D S N L GTIP S   L  L E+ L  NQ++G IP
Sbjct:  126 DNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIP 351          

HSP 3 Score: 70.0922 bits (170), Expect = 9.417e-12
Identity = 40/89 (44.94%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            S+  L +S   L+G IPKEIG  + L +L+L  N+LSG IP E+  L+ L  L L++N LEG IP  + +L+ L E+ L  N+L+G IP
Sbjct:   94 SLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIP 182          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: FLS2_ARATH (LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.663e-19
Identity = 69/207 (33.33%), Postives = 99/207 (47.83%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPAL--------FKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTR-VYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEI-GSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F G+IP       SL +L L  N FNGSIP +L        F  S  +    I G+    +KN      + + NLL   G   + L ++      + +  ++ G    +     ++  LD S N LSG IP E+   M  +  LNL  N+ SG IP   G++  L  LDLSSN L G IP S+++L+ L  + L +N L G +P
Sbjct:  560 NNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNM-QLYLNFSNNLL--TGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVP 763          

HSP 2 Score: 86.2705 bits (212), Expect = 1.270e-16
Identity = 64/206 (31.07%), Postives = 99/206 (48.06%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGK------KYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP E+G+C SL+ L+L  N   G IP  L      Q+ +I  N +         +   + + G  E H  G + E  G   E L  ++  S  NFT    G    +  +  ++  L + +N +SG +P ++G ++ L  L+   N L+GPIP+ + +  GL +LDLS N++ G IP     +  L  I +G N  TG IP
Sbjct:  250 NLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGF-LESLEVLTLHSN-NFT----GEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMN-LTFISIGRNHFTGEIP 448          

HSP 3 Score: 84.3445 bits (207), Expect = 4.825e-16
Identity = 65/198 (32.83%), Postives = 92/198 (46.46%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFI-VGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IP  + +C  L  LDL+ N   G IP       G++   FI +G+ +     +   +     NL        E LS        N T    G  +P       +  L +SYN L+G IP+EIG++  L IL L  N  +G IP E+ +L  L  L + SN LEG IP  M  + LL+ +DL  N+ +G IP
Sbjct:  393 DNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGF----GRMNLTFISIGRNH--FTGEIPDDIFNCSNL--------ETLSVADN----NLT----GTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIP 568          

HSP 4 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 66/200 (33.00%), Postives = 100/200 (50.00%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDI---SYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +NSF G+IP E+G    L  L L  N F+GSIP  +++              Y+ ++N          NLL  +G   E + + S+     F   Y   T       G ++ L +   + N L+GSIP  IG+++ L  L+L  N L+G IP + G+L  L  L L+ N LEG IP+ + + + L +++L  NQLTG IP
Sbjct:  105 SNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIF---------YLDLRN----------NLL--SGDVPEEICKTSSLVLIGFD--YNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIP 281          

HSP 5 Score: 80.1073 bits (196), Expect = 9.100e-15
Identity = 61/198 (30.81%), Postives = 89/198 (44.95%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNL--LEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP ++ +C +L  L +  N   G++ P +    GK+    I+   Y  +     +E    GNL  L    + +   +    R   N T + G               L +  N L G IP+E+  M  L +L+L +N  SG IP     L  L  L L  N+  G+IP+S+ SL+LLN  D+  N LTG IP
Sbjct:  441 NHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLI----GKLQKLRILQVSYNSLTGPIPREI---GNLKDLNILYLHSNGFTGRIPREMSNLTLLQG---------------LRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIP 616          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.953e-19
Identity = 71/207 (34.30%), Postives = 98/207 (47.34%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFI--VGKKYVYIKNDGSKECHGAGNLL-------EFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +NSF G IP  L DCRSL  + L  N F+GS+P   +   G    N +  V   +     + SK   GA NL        EF G   E +  +   +  + +   + G    +    G +  LD+  N  SG +   I S   L  LNL  N  +G IP E+G L  LN LDLS N   G IP S+ SL  LN+++L  N+L+G +P
Sbjct:  381 HNSFSGVIPESLADCRSLTRIRLAYNRFSGSVPTGFW---GLPHVNLLELVNNSF---SGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKIPDEIGSLSVLNYLDLSGNMFSGKIPVSLQSLK-LNQLNLSYNRLSGDLP 580          

HSP 2 Score: 80.4925 bits (197), Expect = 6.968e-15
Identity = 71/246 (28.86%), Postives = 101/246 (41.06%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQ------------SGKIAANFIVGKKYVYIKNDGSKECHGA-------------------------------GNLLE-------FAGIRAERLS--RISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTG 583
            NNS  G IPPELG+ +SL  LD + N   G IP  L +              G++ A+  +      I+  G++   G                                G L E       F+G+  E L+  R  TR    + R + G     F     +  L++  N  SG I K IG  S L +L L +N  +G +P E+G L  LN L  S N+  G++P S+ SL  L  +DL  NQ +G
Sbjct:  262 NNSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGELPASIALSPNLYEIRIFGNRLTGGLPKDLGLNSPLRWLDVSENEFSGDLPADLCAKGELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNR-FSGSVPTGFWGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSG 506          

HSP 3 Score: 73.9442 bits (180), Expect = 6.521e-13
Identity = 61/198 (30.81%), Postives = 93/198 (46.97%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGS-IPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS    +P  +  C+SL  LDL+ NL  G +P  L      +  + + G  +             +G++    G + E L  +S         +  G   P   +  ++  L++SYN  S S IP E G+++ L ++ L   +L G IP  +G L  L  LDL+ N L G IP S+  LT + +I+L  N LTG IP
Sbjct:   93 NNSINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLADIPTLVHLD-LTGNNF-------------SGDIPASFG-KFENLEVLSL-----VYNLLDGTIPPFLGNISTLKMLNLSYNPFSPSRIPPEFGNLTNLEVMWLTECHLVGQIPDSLGQLSKLVDLDLALNDLVGHIPPSLGGLTNVVQIELYNNSLTGEIP 270          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.039e-18
Identity = 66/209 (31.58%), Postives = 104/209 (49.76%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQS-------------GKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G  P EL    SL  LDL+ N F+G++P ++   S             G+I A+  VG  +     D SK+       +E +G+   ++  +   +       + G     F+   S+ ++++S N  SG IP+  G +  L  L+L  N++SG IP E+G+   L +L+L SNRL G IP+ +S L  L  +DLG N L+G IP
Sbjct:  438 NNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPAS--VGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNN-------FSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIP 637          

HSP 2 Score: 89.3521 bits (220), Expect = 1.500e-17
Identity = 72/226 (31.86%), Postives = 106/226 (46.90%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPA---LFKQSG-KIAANFIVGKKYVYIKNDGSKECHGA-GNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFIL------------------------NLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G +P  + +  +L +L+L+ N F+G IP +   LFK +   ++   + G+  V +    + +     GN   F+G+  E  S + +    N +   + G    TF     ++ L +S N +SGSIP EIG+ S L +L                        +LG NNLSG IP E+     LN L L  N L G IP S S L+ L ++DL  N LTG IP
Sbjct:  462 NRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGN--NFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIP 685          

HSP 3 Score: 85.8853 bits (211), Expect = 1.658e-16
Identity = 64/200 (32.00%), Postives = 96/200 (48.00%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   GR P  L +  SL  LD++ NLF+G IPP +      +  K+A N + G+  V IK  GS +      +L+F G   +                  G       +  ++  L +  N  SG +P  + ++  L  LNLG NNL+G  P E+  L  L+ LDLS NR  G +P S+S+L+ L+ ++L  N  +G IP
Sbjct:  318 NRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLD------VLDFEGNSLK------------------GQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIP 493          

HSP 4 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 63/197 (31.98%), Postives = 95/197 (48.22%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAA----NFIVGKKYVYIKNDGSKECHG-AGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            GRI   +   R L  L L +N FNG+IP +L   +  ++     N + GK    ++N  S E    AGN             R+S   P                   S+ FLDIS N  SG IP  + +++ L +LNL +N L+G IP  +G+L+ L  L L  N L+GT+PS++S+ + L  +    N++ G+IP
Sbjct:   82 GRISDRISGLRMLRKLSLRSNSFNGTIPTSLAYCTRLLSVFLQYNSLSGKLPPAMRNLTSLEVFNVAGN-------------RLSGEIPVGLP--------------SSLQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIP 251          

HSP 5 Score: 79.7221 bits (195), Expect = 1.188e-14
Identity = 63/198 (31.82%), Postives = 85/198 (42.93%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTL-LNEIDLGTNQLTGMIP 592
            +NSF G IP   G  R L+ L L+ N  +GSIPP +                             G  + LE   +R+ RL                GH     +    +  LD+  N LSG IP EI   S L  L+L HN+LSG IP     L  L  +DLS N L G IP+S++ ++  L   ++ +N L G IP
Sbjct:  557 SNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEI-----------------------------GNCSALEVLELRSNRLM---------------GHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIPASLALISSNLVYFNVSSNNLKGEIP 710          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: ERECT_ARATH (LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.039e-18
Identity = 65/198 (32.83%), Postives = 96/198 (48.48%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IPPELG+   L +L+LN N   G IPP L    GK+   F               + + A N LE  G   + LS  +  +  N     + G     F    SM +L++S N + G IP E+  +  L  L+L +N ++G IP+ +GDL  L  ++LS N + G +P    +L  + EIDL  N ++G IP
Sbjct:  316 SNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPEL----GKLTDLF---------------DLNVANNDLE--GPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIP 492          

HSP 2 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 63/200 (31.50%), Postives = 98/200 (49.00%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISY---NMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IP  +G+C +   LDL+ N   G IP             F +G  ++ +     +    +G +    G+  + L+ +          +  G   P     G++ F +  Y   N L+GSIP E+G+MS L  L L  N+L+G IP E+G L  L  L++++N LEG IP  +SS T LN +++  N+ +G IP
Sbjct:  221 NNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIP-------------FDIG--FLQVATLSLQGNQLSGKIPSVIGLM-QALAVLDLSG-----NLLSGSIPPIL---GNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIP 396          

HSP 3 Score: 81.6481 bits (200), Expect = 3.128e-15
Identity = 71/248 (28.63%), Postives = 111/248 (44.76%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVG------------KKYVYIKNDGSKECHGA---GNLLEFAGIRAERLSRISTRSPCNFTRVY---------GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLS------------------------SNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G+IP E+GDC SL  LDL+ N  +G IP ++ K    +   +  N ++G            K     +N  S E         +L++ G+R   L    +   C  T ++          G    T  +  +   LD+SYN L+G IP +IG +  +  L+L  N LSG IP+ +G ++ L +LDLS                        SN+L G+IP  + +++ L+ ++L  N LTG IP
Sbjct:  102 NRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQ-VATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIP 348          

HSP 4 Score: 79.7221 bits (195), Expect = 1.188e-14
Identity = 66/244 (27.05%), Postives = 108/244 (44.26%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPAL----FKQSGKIAANFIVGK-----------KYVYIKND---------------------GSKECHGA-------GNLLEFAGIRAERLSRISTRSPCNFTRVY---------GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G I P +GD +SL+ +DL  N  +G IP  +      Q+  ++ N + G            + + +KN+                        +  G          +L++ G+R   L    +   C  T ++          G    T  +  +   LD+SYN L+G IP +IG +  +  L+L  N LSG IP+ +G ++ L +LDLS N L G+IP  + +LT   ++ L +N+LTG IP
Sbjct:   82 GEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQ-VATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIP 324          

HSP 5 Score: 69.707 bits (169), Expect = 1.230e-11
Identity = 53/180 (29.44%), Postives = 89/180 (49.44%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVY-GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSS 526
            NN   G IP  L  C +L  L+++ N F+G+IP A  K        +++N I G   V +   G+ +     N  +  GI    L  +      N +R +  G     F +  S+M +D+S N +SG IP+E+  +  + +L L +NNL+G + + + +   L +L++S N L G IP +
Sbjct:  364 NNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNN-KINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGS-LANCLSLTVLNVSHNNLVGDIPKN 541          

HSP 6 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 42/95 (44.21%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  308 TFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            TFN    ++ L++S   L G I   IG +  L  ++L  N LSG IP E+GD   L  LDLS N L G IP S+S L  L ++ L  NQL G IP
Sbjct:   67 TFN----VVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIP 157          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.772e-18
Identity = 62/196 (31.63%), Postives = 87/196 (44.39%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IPP LG   SL +LDL+ N F G IP +L      ++    V +          K  +  G               +    P +F  +                 +D+SYN L+GSI  E G +  L +LNL +NNLSG IP  +  +  L +LDLS N L G IP S+  L+ L+   +  N+L+G IP
Sbjct:  459 NQLSGTIPPWLGSLNSLFYLDLSNNTFIGEIPHSLTSLQSLVSKENAVEEPSPDFPFFKKKNTNAGG---------------LQYNQPSSFPPM-----------------IDLSYNSLNGSIWPEFGDLRQLHVLNLKNNNLSGNIPANLSGMTSLEVLDLSHNNLSGNIPPSLVKLSFLSTFSVAYNKLSGPIP 622          

HSP 2 Score: 71.2478 bits (173), Expect = 4.227e-12
Identity = 35/85 (41.18%), Postives = 52/85 (61.18%), Query Frame = 2
Query:  338 LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +D++ N   GSIP  IG+ S +  L L  NNLSG IP E+  L  L++L L +NRL G + S +  L+ L  +D+ +N+ +G IP
Sbjct:  187 IDLAMNYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIP 271          

HSP 3 Score: 68.5514 bits (166), Expect = 2.740e-11
Identity = 48/197 (24.37%), Postives = 87/197 (44.16%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP  +G+C S+ +L L +N  +GSIP  LF+ S             + ++N+              +G  + +L ++S     + +   + G     F     + +     N+ +G +P+ + +   + +L+L +N LSG I      +  L  LDL+SN   G+IPS++ +   L  I+    +    IP
Sbjct:  192 NYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNL---------SVLALQNN------------RLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSGSIPSNLPNCLRLKTINFAKIKFIAQIP 367          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
ERL1_ARATH8.498e-2135.15LRR receptor-like serine/threonine-protein kinase ... [more]
RCH1_ARATH1.449e-2033.33LRR receptor-like serine/threonine-protein kinase ... [more]
PEPR1_ARATH1.893e-2034.52Leucine-rich repeat receptor-like protein kinase P... [more]
RCH2_ARATH2.472e-2034.62Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]
Y4265_ARATH4.663e-1934.00Probable LRR receptor-like serine/threonine-protei... [more]
FLS2_ARATH4.663e-1933.33LRR receptor-like serine/threonine-protein kinase ... [more]
HSL1_ARATH7.953e-1934.30Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
Y4361_ARATH1.039e-1831.58Probable LRR receptor-like serine/threonine-protei... [more]
ERECT_ARATH1.039e-1832.83LRR receptor-like serine/threonine-protein kinase ... [more]
PSKR1_DAUCA1.772e-1831.63Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top