DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: GSO1_ARATH (LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.022e-18
Identity = 65/202 (32.18%), Postives = 98/202 (48.51%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGL-NILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N+  G IP +L  C+ L  +DLN N  +G IPP L K S     K+++N  V      + N                     +L  +S            G       + G++  L++  N  SGS+P+ +G +S L+ L L  N+L+G IP E+G L+ L + LDLS N   G IPS++ +L+ L  +DL  NQLTG +P
Sbjct:  632 SNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFN-------------------CTKLLVLSLDG-----NSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVP 809          

HSP 2 Score: 87.8113 bits (216), Expect = 4.364e-17
Identity = 68/201 (33.83%), Postives = 94/201 (46.77%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGH-----TQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G +P  LG+C  L  LDL  N  +GSIP +           F+ G + + + N+  +     GNL +         S IS R   N TR+   H     T      + S +  D++ N     IP E+G+   L  L LG N L+G IP  +G +R L++LD+SSN L GTIP  +     L  IDL  N L+G IP
Sbjct:  490 NELVGGLPASLGNCHQLNILDLADNQLSGSIPSSF---------GFLKGLEQLMLYNNSLQ-----GNLPD---------SLISLR---NLTRINLSHNRLNGTIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIP 664          

HSP 3 Score: 85.5001 bits (210), Expect = 2.166e-16
Identity = 61/192 (31.77%), Postives = 88/192 (45.83%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G IP EL  C+SL  LDL+ N   GSIP ALF+         +V    +Y+ N          N LE                         G   P+ ++  ++ +L + +N L G +PKEI ++  L +L L  N  SG IP E+G+   L ++D+  N  EG IP S+  L  LN + L  N+L G +P
Sbjct:  350 GEIPVELSKCQSLKQLDLSNNSLAGSIPEALFE---------LVELTDLYLHN----------NTLE-------------------------GTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLP 497          

HSP 4 Score: 84.3445 bits (207), Expect = 4.825e-16
Identity = 66/207 (31.88%), Postives = 99/207 (47.83%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGK------KYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N+  G IP  L +  SL  L L +N   G IP  L      +S +I  N +VG         V ++      C   G +    G    RL R+  +S         G       +   +     + NML+G+IP E+G +  L ILNL +N+L+G IP+++G++  L  L L +N+L+G IP S++ L  L  +DL  N LTG IP
Sbjct:  104 SNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLG----RLVRV--QSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIP 304          

HSP 5 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 62/197 (31.47%), Postives = 95/197 (48.22%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F   IP ELG+ ++L  L L  N   G IP  L    GKI        + + + +  S    G    +    +  ++L+ I   +  NF     G   P       +  L +S N    S+P E+ + + L +L+L  N+L+G IP E+G+L  LN+L+L  N+  G++P +M  L+ L E+ L  N LTG IP
Sbjct:  584 NNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTL----GKI--------RELSLLDMSSNALTGT---IPLQLVLCKKLTHIDLNN--NFL---SGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIP 760          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1341_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 3.947e-18
Identity = 64/196 (32.65%), Postives = 99/196 (50.51%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNI-LDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            N   G+IP E+G+ ++L++LDL  N F+G +P  +      I    ++     YI  D   +    GNL+    +   R S             + G+   +F +   +  L ++ N+L+G IPK I ++  L +L+L +N+LSG IP E+G +  L I LDLS N   G IP + S LT L  +DL +N L G I
Sbjct:  462 NQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEI----SNITVLELLDVHNNYITGDIPAQL---GNLVNLEQLDLSRNS-------------FTGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIPETFSDLTQLQSLDLSSNSLHGDI 637          

HSP 2 Score: 82.8037 bits (203), Expect = 1.404e-15
Identity = 64/224 (28.57%), Postives = 101/224 (45.09%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSM------------------------SYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NS  G IPPE+ +C SL+  D++ N   G IP  L K    +  +++ N   G+    + N  S              I ++  +  S +S   +     G    +F +   ++ LD+S N L+G IP+E+ S+                          L  L +G N LSG IP E+G+L+ L  LDL  N   G +P  +S++T+L  +D+  N +TG IP
Sbjct:  294 NSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFFLWENSISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIP 517          

HSP 3 Score: 80.4925 bits (197), Expect = 6.968e-15
Identity = 68/225 (30.22%), Postives = 99/225 (44.00%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQ-------------SGKIAANFIVGKKYVYIKNDGS-------KECHGAGNLL-------EFAGIRAERLSRISTRSPCNFTRVY-GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLN-EIDLGTNQLTGMIP 592
            NS  G IP   G+C  L+ LDL+ N   G IP  LF               SG +  +    +  V ++   +       KE     NL+        F+G     +S I+     +    Y  G       +  ++  LD+S N  +G+IP   G++SYL  L L +N L+G IP  + +L+ L +LDLS N L G IP  +  +T L   +DL  N  TG IP
Sbjct:  390 NSISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIP 614          

HSP 4 Score: 80.1073 bits (196), Expect = 9.100e-15
Identity = 42/96 (43.75%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  305 PTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            P  +   S+ FL++S   LSG IP   G +++L +L+L  N+LSGPIP+E+G L  L  L L++N+L G+IPS +S+L  L  + L  N L G IP
Sbjct:   85 PDLSSLSSLQFLNLSSTNLSGPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQISNLFALQVLCLQDNLLNGSIP 180          

HSP 5 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 60/213 (28.17%), Postives = 90/213 (42.25%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPAL--------FKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSR---------ISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP ++ +  +L  L L  NL NGSIP +         F+  G       +  +  ++KN            L   G  A  LS          ++ ++   +     G   P       +  L +  N L+GSIPKE+G +  +  L L  N+LSG IP E+ +   L + D+S+N L G IP  +  L  L ++ L  N  TG IP
Sbjct:  149 NKLSGSIPSQISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKN------------LTTLGFAASGLSGSIPSTFGNLVNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTGSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIP 349          

HSP 6 Score: 77.0258 bits (188), Expect = 7.704e-14
Identity = 61/197 (30.96%), Postives = 92/197 (46.70%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAG----NLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G IPP+LG C  L  L L+ N   GSIP  L K   KI +  + G     +       C        +  +  G     L ++        +  ++ G      ++  S++ L +  N LSGSIP +IG++  L    L  N++SG IP+  G+   L  LDLS N+L G IP  + SL  L+++ L  N L+G +P
Sbjct:  250 GTIPPQLGLCSELRNLYLHMNKLTGSIPKELGKLQ-KITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFFLWENSISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGNSLSGGLP 445          

HSP 7 Score: 76.2554 bits (186), Expect = 1.314e-13
Identity = 45/101 (44.55%), Postives = 57/101 (56.44%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTN-QLTGMIP 592
            G   P+F     +  LD+S N LSG IP E+G +S L  L L  N LSG IP+++ +L  L +L L  N L G+IPSS  SL  L +  LG N  L G IP
Sbjct:  105 GPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIP 205          

HSP 8 Score: 68.5514 bits (166), Expect = 2.740e-11
Identity = 46/111 (41.44%), Postives = 61/111 (54.95%), Query Frame = 2
Query:  260 RSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            ++PC++     G T    N   S+   D   N+   SIP ++ S+S L  LNL   NLSGPIP   G L  L +LDLSSN L G IPS +  L+ L  + L  N+L+G IP
Sbjct:   53 QTPCSWY----GITCSADNRVISVSIPDTFLNL--SSIP-DLSSLSSLQFLNLSSTNLSGPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIP 156          

HSP 9 Score: 68.5514 bits (166), Expect = 2.740e-11
Identity = 54/189 (28.57%), Postives = 90/189 (47.62%), Query Frame = 2
Query:   29 PELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHN-NLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            P+L    SL +L+L++   +G IPP+     GK+    ++      +      E  G  + L+F  + A +LS               G      ++  ++  L +  N+L+GSIP   GS+  L    LG N NL GPIP ++G L+ L  L  +++ L G+IPS+  +L  L  + L   +++G IP
Sbjct:   85 PDLSSLSSLQFLNLSSTNLSGPIPPSF----GKLTHLRLLDLSSNSLSGPIPSEL-GRLSTLQFLILNANKLS---------------GSIPSQISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKNLTTLGFAASGLSGSIPSTFGNLVNLQTLALYDTEISGTIP 253          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: CLV1_ARATH (Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 5.155e-18
Identity = 58/201 (28.86%), Postives = 93/201 (46.27%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F+G IP ELG C+SL  + +  NL NG++P  LF        ++  NF  G+  V +  D   + + + N                          + G   P   +  ++  L +  N   G+IP+EI  + +L  +N   NN++G IP  +     L  +DLS NR+ G IP  ++++  L  +++  NQLTG IP
Sbjct:  394 NNFFFGPIPEELGKCKSLTKIRIVKNLLNGTVPAGLFNLPLVTIIELTDNFFSGELPVTMSGDVLDQIYLSNNW-------------------------FSGEIPPAIGNFPNLQTLFLDRNRFRGNIPREIFELKHLSRINTSANNITGGIPDSISRCSTLISVDLSRNRINGEIPKGINNVKNLGTLNISGNQLTGSIP 569          

HSP 2 Score: 87.0409 bits (214), Expect = 7.444e-17
Identity = 60/197 (30.46%), Postives = 91/197 (46.19%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN+F G++PPE+ + + L +L    N F+G IP                             E +G    LE+ G+     + +S +SP   +R+           N   M++   YN  +G +P E G ++ L IL++    L+G IPT + +L+ L+ L L  N L G IP  +S L  L  +DL  NQLTG IP
Sbjct:  153 NNNFNGKLPPEMSELKKLKYLSFGGNFFSGEIP-----------------------------ESYGDIQSLEYLGLNG---AGLSGKSPAFLSRL----------KNLREMYIGY-YNSYTGGVPPEFGGLTKLEILDMASCTLTGEIPTSLSNLKHLHTLFLHINNLTGHIPPELSGLVSLKSLDLSINQLTGEIP 306          

HSP 3 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 60/196 (30.61%), Postives = 88/196 (44.90%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G IPPEL    SL  LDL+ N   G IP +          N      Y  I      E  G    LE   +     +  + + P N  R            NG+++ LD+S N L+G IPK++     L +L L +N   GPIP E+G  + L  + +  N L GT+P+ + +L L+  I+L  N  +G +P
Sbjct:  275 NNLTGHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIP-----EAIGELPKLEVFEVWE---NNFTLQLPANLGR------------NGNLIKLDVSDNHLTGLIPKDLCRGEKLEMLILSNNFFFGPIPEELGKCKSLTKIRIVKNLLNGTVPAGLFNLPLVTIIELTDNFFSGELP 450          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1124_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 6.733e-18
Identity = 68/201 (33.83%), Postives = 100/201 (49.75%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   GRIP  +  C+SL  LDL +N  NGSIP ++ K       ++  N I G   V  ++ GS E     NL          L+ I             G      ++   ++ LD+S N L G I K++ +++ + IL+L  N L+G IP E+G+L  +  LDLS N L G IPSS+ SL  L   ++  N L+G+IP
Sbjct:  293 SNELTGRIPTGVMGCKSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDG---VIPRDIGSLEFLQVLNL--------HNLNLI-------------GEVPEDISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSIPPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYNNLSGVIP 469          

HSP 2 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 55/210 (26.19%), Postives = 100/210 (47.62%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK-------------QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N+ +G IP  + +C +L+  D + N   G +PP +                SG ++      ++ + + + GS   HG   L  FA +  + ++  +     ++ R +GG      + + S+ FLD S N L+G IP  +     L +L+L  N L+G IP  +G +  L+++ L +N ++G IP  + SL  L  ++L    L G +P
Sbjct:  173 HNNIFGSIPASIVNCNNLVGFDFSYNNLKGVLPPRICDIPVLEYISVRNNLLSGDVSEEIQKCQRLILV-DLGSNLFHG---LAPFAVLTFKNITYFNV----SWNR-FGGEIGEIVDCSESLEFLDASSNELTGRIPTGVMGCKSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLNLIGEVP 373          

HSP 3 Score: 74.3294 bits (181), Expect = 4.993e-13
Identity = 63/228 (27.63%), Postives = 98/228 (42.98%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGK-------------------IAANFIVGKKYVYIKNDG---SKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHN---------GSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N+  G IP  + +  SL +LDL+ N F G IP +LFK   K                   +  N +VG  + Y    G    + C     +LE+  +R   LS   +       R+          H           ++ + ++S+N   G I + +     L  L+   N L+G IPT V   + L +LDL SN+L G+IP S+  +  L+ I LG N + G+IP
Sbjct:  124 SNALSGPIPEFISELSSLRFLDLSKNGFTGEIPVSLFKFCDKTKFVSLAHNNIFGSIPASIVNCNNLVGFDFSYNNLKGVLPPRICDIP--VLEYISVRNNLLSGDVSEEIQKCQRLILVDLGSNLFHGLAPFAVLTFKNITYFNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRIPTGVMGCKSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIP 349          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y4885_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3)

HSP 1 Score: 89.7373 bits (221), Expect = 1.148e-17
Identity = 65/213 (30.52%), Postives = 102/213 (47.89%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVG-------------KKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IPPELGD  +L  L L  N  NGSIP  + + +      I  N + G               Y++I +         GNL     +  +R          N T    G    +F +  ++  L++  N LSG IP EIG+M+ L  L+L  N L+GPIP+ +G+++ L +L L  N+L G+IP  +  +  + ++++  N+LTG +P
Sbjct:  152 NQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRN---------NLT----GKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVP 351          

HSP 2 Score: 81.2629 bits (199), Expect = 4.085e-15
Identity = 57/197 (28.93%), Postives = 91/197 (46.19%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IPPE+ +   L  LDL++N   G +P ++     +I+   + G +       G +        LE+  + + R S                   PT N+   + ++++S N L  +IP+ +  +S L +L+L +N L G I ++   L+ L  LDLS N L G IP S   +  L  +D+  N L G IP
Sbjct:  487 NNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESI-SNINRISKLQLNGNRLSGKIPSGIRLLTN----LEYLDLSSNRFS---------------SEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGPIP 663          

HSP 3 Score: 75.8702 bits (185), Expect = 1.716e-13
Identity = 54/204 (26.47%), Postives = 97/204 (47.55%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHG------AGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IPP + +   L  L L+TN F G +P  + +  GK+    +    +        ++C         GN   F+G  +E      T +  + +   + G     +  +  ++   +S N ++G+IP EI +M+ L  L+L  N ++G +P  + ++  ++ L L+ NRL G IPS +  LT L  +DL +N+ +  IP
Sbjct:  367 DNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICR-GGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGN--SFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIP 567          

HSP 4 Score: 70.4774 bits (171), Expect = 7.210e-12
Identity = 42/105 (40.00%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  278 TRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            T + G      F+   ++ F+D+S N  SG+I    G  S L   +L  N L G IP E+GDL  L+ L L  N+L G+IPS +  LT + EI +  N LTG IP
Sbjct:  103 TGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIP 207          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: GSO2_ARATH (LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.148e-17
Identity = 69/201 (34.33%), Postives = 94/201 (46.77%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQ----SGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGL-NILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NS  G IP ELG C+ L  +DLN N  +G IP  L K       K+++N  VG            E     N+L    +    L+               G       +  ++  L++  N LSG +P  IG +S LF L L  N L+G IP E+G L+ L + LDLS N   G IPS++S+L  L  +DL  NQL G +P
Sbjct:  634 NSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSL--------PTEIFSLTNILTLF-LDGNSLN---------------GSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVP 810          

HSP 2 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 66/221 (29.86%), Postives = 103/221 (46.61%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAA-----NFIVGK------KYVYIKND--GSKECHGA-----GNLLEFAGIRAERLSRISTRSPCNFTRVYG------------GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            G I P +G   +LI +DL++N   G IP  L   S  + +     N + G         V +K+   G  E +G      GNL+    + A    R++   P  F R+              G       +  S+     ++N L+GS+P E+  +  L  LNLG N+ SG IP+++GDL  +  L+L  N+L+G IP  ++ L  L  +DL +N LTG+I
Sbjct:   85 GSISPSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFGNLVNLQML-ALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVI 304          

HSP 3 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 64/195 (32.82%), Postives = 93/195 (47.69%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISY---NMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G IP E+ +C+SL  LDL+ N   G IP +LF+         +V    +Y+ N          N LE  G  +  +S ++      FT  +           G +  L+I Y   N  SG +P EIG+ + L  ++   N LSG IP+ +G L+ L  L L  N L G IP+S+ +   +  IDL  NQL+G IP
Sbjct:  351 GEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQ---------LVELTNLYLNN----------NSLE--GTLSSSISNLTNLQ--EFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIP 522          

HSP 4 Score: 83.5741 bits (205), Expect = 8.231e-16
Identity = 64/197 (32.49%), Postives = 92/197 (46.70%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G +P  L + ++L  ++ ++N FNGSI P     S              Y+  D ++        LE    ++  L R+           + G    TF     +  LDIS N LSG IP E+G    L  ++L +N LSG IPT +G L  L  L LSSN+  G++P+ + SLT +  + L  N L G IP
Sbjct:  538 NNSLQGNLPDSLINLKNLTRINFSSNKFNGSISPLCGSSS--------------YLSFDVTENGFEGDIPLELG--KSTNLDRLRLGK-----NQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIP 713          

HSP 5 Score: 75.485 bits (184), Expect = 2.241e-13
Identity = 64/203 (31.53%), Postives = 97/203 (47.78%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKE-CHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSY-LFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            +N   G IP E+G+C SL       N  NGS+P  L +    Q+  +  N   G+    + +  S +  +  GN L+  G+  +RL+ ++     + +     G     F     + FL ++ N LSGS+PK I S +  L  L L    LSG IP E+ + + L +LDLS+N L G IP S+  L  L  + L  N L G +
Sbjct:  201 DNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQ--GLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTL 401          

HSP 6 Score: 68.5514 bits (166), Expect = 2.740e-11
Identity = 40/93 (43.01%), Postives = 53/93 (56.99%), Query Frame = 2
Query:  314 NHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N + S+  L +  N+LSG IP ++GS+  L  L LG N L+G IP   G+L  L +L L+S RL G IPS    L  L  + L  N+L G IP
Sbjct:  117 NLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIP 209          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1743_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.559e-17
Identity = 66/196 (33.67%), Postives = 90/196 (45.92%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP E+G   SL  L L  N F+  IP  L   +  +               D S+   G G++ E  G    R +++      +     GG          ++  LD+ YN  SG +P EI  +  L  L L +NN SG IP E G++ GL  LDLS N+L G+IP+S   LT L  + L  N L+G IP
Sbjct:  286 NKFTGNIPAEIGSISSLKGLYLGNNTFSRDIPETLLNLTNLVFL-------------DLSRNKFG-GDIQEIFG----RFTQVKYLV-LHANSYVGGINSSNILKLPNLSRLDLGYNNFSGQLPTEISQIQSLKFLILAYNNFSGDIPQEYGNMPGLQALDLSFNKLTGSIPASFGKLTSLLWLMLANNSLSGEIP 462          

HSP 2 Score: 87.0409 bits (214), Expect = 7.444e-17
Identity = 63/209 (30.14%), Postives = 90/209 (43.06%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPC-----NFTRVYG-------GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G IP E+G+C SL+W ++  N  +G   P L +     +  F V ++       GS EC      +         +  I T+  C     +  + YG       G T  T   +    +L +S N  SG IP  I  M  L  L+LG N   G +P E+G L  L  L+L+ N   G IP  + +L  L  +DL  N  +G  P
Sbjct:  454 NNSLSGEIPREIGNCTSLLWFNVANNQLSGRFHPELTRMGSNPSPTFEVNRQNKDKIIAGSGECLAMKRWIPAEFPPFNFVYAILTKKSCRSLWDHVLKGYGLFPVCSAGSTVRTLKISA---YLQLSGNKFSGEIPASISQMDRLSTLHLGFNEFEGKLPPEIGQL-PLAFLNLTRNNFSGEIPQEIGNLKCLQNLDLSFNNFSGNFP 658          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1571_ARATH (Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.559e-17
Identity = 68/201 (33.83%), Postives = 101/201 (50.25%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAA----NFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVY-GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IPPELG+  S+  L L+ N   GSIP  L      +      N++ G     I N  S   + A +  +  G     L  +   +  +  + Y  G   P   +  SM+ L++S N L+GSIP  +G++  L IL L  N L+G IP E+G++  +  L L++N+L G+IPSS  +L  L  + L  N LTG+IP
Sbjct:  208 NYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMT-NLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIP 407          

HSP 2 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 65/206 (31.55%), Postives = 96/206 (46.60%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVY------GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IPPE+G+  S+  L L+ N   GSIP +L          +  N++ G     + N  S         LE +  +       S  +  N T +Y       G   P   +  SM+ L ++ N L+GSIP   G++  L  L L  N L+G IP E+G++  +  LDLS N+L G++P S  + T L  + L  N L+G IP
Sbjct:  256 NYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMID------LELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIP 455          

HSP 3 Score: 79.337 bits (194), Expect = 1.552e-14
Identity = 56/209 (26.79%), Postives = 93/209 (44.50%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRV------------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN+  G IP E+ +   L+ LDL+TN   G +P A+                               GNL   + +R    +++S R P   + +            +      TF+    +  +++S N   GSIP+ +  ++ L  L+L HN L G IP+++  L+ L+ LDLS N L G IP++   +  L  +D+  N+L G +P
Sbjct:  567 NNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAI-------------------------------GNLTNLSRLRLNG-NQLSGRVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPR-LSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPTTFEGMIALTNVDISNNKLEGPLP 742          

HSP 4 Score: 78.5666 bits (192), Expect = 2.648e-14
Identity = 59/204 (28.92%), Postives = 97/204 (47.55%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLL-------EFAGIRAERLSRISTRSPCNFTR-VYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IPP + +   L  L L+TN F G  P  + K  G+   N  +   Y +++    K      +L+       +F G   E        +  +F+   + G     +  +  +  L +S N ++G+IP EI +M+ L  L+L  NNL G +P  +G+L  L+ L L+ N+L G +P+ +S LT L  +DL +N  +  IP
Sbjct:  448 NHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCK--GRKLQN--ISLDYNHLEGPIPKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIP 647          

HSP 5 Score: 75.0998 bits (183), Expect = 2.927e-13
Identity = 57/182 (31.32%), Postives = 92/182 (50.55%), Query Frame = 2
Query:   50 SLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPT-FNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +L ++DL+ NL +G+IPP    Q G ++       K +Y     +   H  G +       +  L  +   +     + Y     P+   +  SM  L +S N L+GSIP  +G++  L +L L  N L+G IP E+G++  +  L LS N+L G+IPS++ +L  L  + L  N LTG+IP
Sbjct:  103 NLAYVDLSMNLLSGTIPP----QFGNLS-------KLIYFDLSTN---HLTGEI-------SPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIP 263          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: IKU2_ARATH (Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.559e-17
Identity = 66/201 (32.84%), Postives = 99/201 (49.25%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G+ P     C++LI L ++ N  +G IP  ++     Q   +A+N+  G     I N  S       N   F+G    ++S  ++    N     + G    +F     +  L +  N LSG+IPK +G  + L  LN   N+LS  IP  +G L+ LN L+LS N+L G IP  +S+L  L+ +DL  NQLTG +P
Sbjct:  374 NRFTGQFPESYAKCKTLIRLRVSNNSLSGMIPSGIWGLPNLQFLDLASNYFEGNLTGDIGNAKSLGSLDLSNN-RFSGSLPFQISGANSLVSVNLRMNKFSGIVPESFGKLKELSSLILDQNNLSGAIPKSLGLCTSLVDLNFAGNSLSEEIPESLGSLKLLNSLNLSGNKLSGMIPVGLSALK-LSLLDLSNNQLTGSVP 572          

HSP 2 Score: 69.3218 bits (168), Expect = 1.606e-11
Identity = 57/196 (29.08%), Postives = 87/196 (44.39%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIR-AERLSRISTRSPCNFTRVYGGHTQPTFNHN-GSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTG 583
            NNS  G+I   LG C  L +LDL  N F+G  P     Q       F+            S    G   +  ++ ++  +RLS +S          +G H  P    N  ++ ++ +S + ++G IP+ I ++  L  L L  N +SG IP E+  L+ L  L++ SN L G +P    +LT L   D   N L G
Sbjct:  109 NNSLRGQIGTNLGKCNRLRYLDLGINNFSGEFPAIDSLQ----LLEFL------------SLNASGISGIFPWSSLKDLKRLSFLSVGD-----NRFGSHPFPREILNLTALQWVYLSNSSITGKIPEGIKNLVRLQNLELSDNQISGEIPKEIVQLKNLRQLEIYSNDLTGKLPLGFRNLTNLRNFDASNNSLEG 283          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y2317_ARATH (Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.444e-17
Identity = 63/208 (30.29%), Postives = 100/208 (48.08%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKN-------DGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFI-LNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G +PPE+G C+ L  L L  N F+ ++P  + K S      +++N + G     I N       D S+         E   +    + R+S          + G+   T  +   +  L +  N+ SGSIP ++G +S L I +NL +N+ SG IP E+G+L  L  L L++N L G IP++  +L+ L   +   N LTG +P
Sbjct:  503 NRFSGPLPPEIGTCQKLQRLHLAANQFSSNLPNEISKLSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEILRLSENR-------FSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYNDFSGEIPPEIGNLHLLMYLSLNNNHLSGEIPTTFENLSSLLGCNFSYNNLTGQLP 703          

HSP 2 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 70/224 (31.25%), Postives = 99/224 (44.20%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFI-----------VGKKY------VYIKNDGSKECHGAGNLLEFAGIRA---ERLSRISTR-SPCNFTRVYG-------GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+  G IP E+G+C  L  + LN N F GSIP  + K S   + N             +G  Y       Y  N         GNL +    RA   +    I T    C   ++ G       G           +  + +  N  SG IPK+IG+++ L  L L  N+L GPIP+E+G+++ L  L L  N+L GTIP  +  L+ + EID   N L+G IP
Sbjct:  119 NALTGDIPREIGNCSKLEVMFLNNNQFGGSIPVEINKLSQLRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLPRSLGNLNKLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSGFIPKDIGNLTSLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLLSGEIP 342          

HSP 3 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 61/200 (30.50%), Postives = 97/200 (48.50%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGH-TQPTFNHNGSMMFLDISY---NMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP E+G C +L  L L  N  +G +P    K+ G +    +  ++ +  +N             +F+G   + +  +++        +YG     P  +  G+M  L   Y   N L+G+IPKE+G +S +  ++   N LSG IP E+  +  L +L L  N+L G IP+ +S L  L ++DL  N LTG IP
Sbjct:  215 NDFSGNIPTEIGKCLNLKLLGLAQNFISGELP----KEIGML----VKLQEVILWQN-------------KFSGFIPKDIGNLTSLETL---ALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINSLTGPIP 390          

HSP 4 Score: 78.9518 bits (193), Expect = 2.027e-14
Identity = 64/200 (32.00%), Postives = 95/200 (47.50%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLL---EFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NS  G IP E+G+ +SL  L L  N  NG+IP  L K S  +  +F        I  + SK        L   +  GI    LS++   +  + +     G   P F +  SM  L + +N LSG IP+ +G  S L++++   N LSG IP  +     L +L+L SNR+ G IP  +     L ++ +  N+LTG  P
Sbjct:  287 NSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINSLTGPIPPGFQNLTSMRQLQLFHNSLSGVIPQGLGLYSPLWVVDFSENQLSGKIPPFICQQSNLILLNLGSNRIFGNIPPGVLRCKSLLQLRVVGNRLTGQFP 486          

HSP 5 Score: 78.9518 bits (193), Expect = 2.027e-14
Identity = 61/204 (29.90%), Postives = 92/204 (45.10%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHG------AGNLLEFAGIRAERLSRISTRSPCNFTRV-YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +NS  G IP  LG    L  +D + N  +G IPP + +QS  I  N    + +  I   G   C         GN L   G     L ++   S     +  + G   P       +  L ++ N  S ++P EI  +S L   N+  N+L+GPIP+E+ + + L  LDLS N   G++P  + SL  L  + L  N+ +G IP
Sbjct:  406 HNSLSGVIPQGLGLYSPLWVVDFSENQLSGKIPPFICQQSNLILLNLGSNRIFGNIP-PGVLRCKSLLQLRVVGNRL--TGQFPTELCKLVNLSAIELDQNRFSGPLPPEIGTCQKLQRLHLAANQFSSNLPNEISKLSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEILRLSENRFSGNIP 606          

HSP 6 Score: 72.7886 bits (177), Expect = 1.453e-12
Identity = 35/100 (35.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G   P+     ++++L+++YN L+G IP+EIG+ S L ++ L +N   G IP E+  L  L   ++ +N+L G +P  +  L  L E+   TN LTG +P
Sbjct:   99 GIVSPSIGGLVNLVYLNLAYNALTGDIPREIGNCSKLEVMFLNNNQFGGSIPVEINKLSQLRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLP 198          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
GSO1_ARATH3.022e-1832.18LRR receptor-like serine/threonine-protein kinase ... [more]
Y1341_ARATH3.947e-1832.65Probable LRR receptor-like serine/threonine-protei... [more]
CLV1_ARATH5.155e-1828.86Receptor protein kinase CLAVATA1 OS=Arabidopsis th... [more]
Y1124_ARATH6.733e-1833.83Probable LRR receptor-like serine/threonine-protei... [more]
Y4885_ARATH1.148e-1730.52Probable LRR receptor-like serine/threonine-protei... [more]
GSO2_ARATH1.148e-1734.33LRR receptor-like serine/threonine-protein kinase ... [more]
Y1743_ARATH2.559e-1733.67Probable LRR receptor-like serine/threonine-protei... [more]
Y1571_ARATH2.559e-1733.83Probable leucine-rich repeat receptor-like protein... [more]
IKU2_ARATH2.559e-1732.84Receptor-like protein kinase HAIKU2 OS=Arabidopsis... [more]
Y2317_ARATH7.444e-1730.29Probable leucine-rich repeat receptor-like protein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top