DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RLK5_ARATH (Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.444e-17
Identity = 67/199 (33.67%), Postives = 92/199 (46.23%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGS--KECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN   G+IP        L  L+L+ N F GSIP  +     K  +N  + K     +  GS   E      ++E +G   +                + G    +      +  LD+S N LSG IP+E+     L  LNL +N+LSG IP EVG L  LN LDLSSN+  G IP  + +L  LN ++L  N L+G IP
Sbjct:  412 NNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTII--GAKNLSNLRISKN----RFSGSIPNEIGSLNGIIEISGAEND----------------FSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIPLELQNLK-LNVLNLSYNHLSGKIP 587          

HSP 2 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 67/211 (31.75%), Postives = 99/211 (46.92%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLS--RISTRSPCNFTRV------------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN   G +P +LG    L ++DL+ N F+G IP  +  +          GK    I  D S     + NL +   +   RLS  ++S + P  F  +            + G    T     ++  L IS N  SGSIP EIGS++ +  ++   N+ SG IP  +  L+ L+ LDLS N+L G IP  +     LNE++L  N L+G IP
Sbjct:  340 NNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIPANVCGE----------GKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNELNLANNHLSGEIP 540          

HSP 3 Score: 70.8626 bits (172), Expect = 5.521e-12
Identity = 56/196 (28.57%), Postives = 92/196 (46.94%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+    IP   G+ R L  L+L  N  +G+IP +L    G +    +   K  Y     S+     GNL E          ++   + CN      G   P+ +   S++ LD+++N L+GSIP  I  +  +  + L +N+ SG +P  +G++  L   D S N+L G IP +++ L  L  ++L  N L G +P
Sbjct:  149 NNLSDTIPSSFGEFRKLESLNLAGNFLSGTIPASL----GNVTT--LKELKLAYNLFSPSQIPSQLGNLTEL---------QVLWLAGCNLV----GPIPPSLSRLTSLVNLDLTFNQLTGSIPSWITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTGKIPDNLNLLN-LESLNLFENMLEGPLP 324          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 87.0409 bits (214), Expect = 7.444e-17
Identity = 60/196 (30.61%), Postives = 96/196 (48.98%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP  +GD ++L +LDL+ N F G IP +L K     + N  V        N+ S +         F       + R  +     + +++G    PT         +++ +N LSG I +E G++  L + +L  N LSG IP+ +  +  L  LDLS+NRL G+IP S+  L+ L++  +  N L+G+IP
Sbjct:  449 NRLTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISV--------NEPSPD-------FPFF------MKRNESARALQYNQIFG--FPPT---------IELGHNNLSGPIWEEFGNLKKLHVFDLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQLSFLSKFSVAYNNLSGVIP 612          

HSP 2 Score: 72.7886 bits (177), Expect = 1.453e-12
Identity = 55/192 (28.65%), Postives = 89/192 (46.35%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFN--HNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQ 574
            N F GR+P  L DC+ L  ++L  N F+G +P + FK    ++        Y  + N          N+    GI    L      +    T  + G   P  +  H   +  L ++   L+GS+P+ + S + L +L+L  N L+G IP+ +GD + L  LDLS+N   G IP S++ L  L   ++  N+
Sbjct:  326 NRFNGRLPENLPDCKRLKNVNLARNTFHGQVPES-FKNFESLS--------YFSLSNSS------LANISSALGI----LQHCKNLTTLVLTLNFHGEALPDDSSLHFEKLKVLVVANCRLTGSMPRWLSSSNELQLLDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISVNE 498          

HSP 3 Score: 70.8626 bits (172), Expect = 5.521e-12
Identity = 61/221 (27.60%), Postives = 97/221 (43.89%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG-----KIAANFIVGK------KYVYIKNDGSKECHGAGNL-------------LEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IP  + +  +L   DL++N FNGS+P  +   S      K+A N+  G       K V +++     C G  +L             L   GI+  RLS   +R   N +               S++ LD+S+N+ SG IP     +  L       N   G IP  + +   LN+L+L +N L G +  + +++  LN +DLGTN+  G +P
Sbjct:  133 SNDLSGGIPTSI-NLPALQSFDLSSNKFNGSLPSHICHNSTQIRVVKLAVNYFAGNFTSGFGKCVLLEH----LCLGMNDLTGNIPEDLFHLKRLNLLGIQENRLSGSLSREIRNLS---------------SLVRLDVSWNLFSGEIPDVFDELPQLKFFLGQTNGFIGGIPKSLANSPSLNLLNLRNNSLSGRLMLNCTAMIALNSLDLGTNRFNGRLP 333          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y2579_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.270e-16
Identity = 66/203 (32.51%), Postives = 96/203 (47.29%), Query Frame = 2
Query:    2 NNSFYGRIPPEL--GDCRSLIWLDLNTNLFNGSIP----PALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN+  G IP ++      SL +L+L+ N F+GSIP    P L+     ++ N   G+ Y               ++  F+ +R   L             V  GH      +   + FL ++ N L+G +P E+G M  L  + LG+NNLSG IP ++G L  LN LDL  N L G IP S+  L  L  + L  N+L+G IP
Sbjct:  106 NNNLSGPIPHDIFTTSSPSLRYLNLSNNNFSGSIPRGFLPNLYTLD--LSNNMFTGEIY--------------NDIGVFSNLRVLDLGG----------NVLTGHVPGYLGNLSRLEFLTLASNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIP 282          

HSP 2 Score: 85.8853 bits (211), Expect = 1.658e-16
Identity = 68/203 (33.50%), Postives = 96/203 (47.29%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNL--LEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN+F G IP   G   +L  LDL+ N+F G I   +   S      +  N + G    Y+           GNL  LEF  + + +L+               G          ++ ++ + YN LSG IP +IG +S L  L+L +NNLSGPIP  +GDL+ L  + L  N+L G IP S+ SL  L  +D   N L+G IP
Sbjct:  132 NNNFSGSIPR--GFLPNLYTLDLSNNMFTGEIYNDIGVFSNLRVLDLGGNVLTGHVPGYL-----------GNLSRLEFLTLASNQLT---------------GGVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIP 306          

HSP 3 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 65/198 (32.83%), Postives = 92/198 (46.46%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGS-KECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G +P ELG  ++L W+ L  N  +G IP   ++  G  + N +     VY    G      G    LE+  +   +LS               G   P+     +++ LD S N LSG IP+ +  M  L IL+L  NNL+G IP  V  L  L +L L SNR  G IP+++     L  +DL TN LTG +P
Sbjct:  202 SNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIP---YQIGGLSSLNHL---DLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLS---------------GQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTNNLTGKLP 378          

HSP 4 Score: 83.5741 bits (205), Expect = 8.231e-16
Identity = 60/197 (30.46%), Postives = 97/197 (49.24%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +NS   +IPP LG C+SL  + L  N F+G +P    K       NF+       + N+  +     GN+  +   + E L         +  + +G    P F+ +  +  LD+S N +SG +P+ + +   +  L+L  N ++G IP E+   + L  LDLS N   G IPSS +   +L+++DL  NQL+G IP
Sbjct:  394 SNSLDSQIPPSLGMCQSLERVRLQNNGFSGKLPRGFTKLQ---LVNFLD------LSNNNLQ-----GNINTWDMPQLEMLD-------LSVNKFFG--ELPDFSRSKRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLDLSHNNFTGEIPSSFAEFQVLSDLDLSCNQLSGEIP 567          

HSP 5 Score: 72.7886 bits (177), Expect = 1.453e-12
Identity = 64/205 (31.22%), Postives = 93/205 (45.37%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCN-FTRVYG---GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F G I  ++G   +L  LDL  N+  G +P  L   S      +A+N + G   V +     K  +     L +  +  E   +I   S  N    VY    G   P+      + ++ +  N LSG IP  I S+  L  L+   N+LSG IP  V  ++ L IL L SN L G IP  ++SL  L  + L +N+ +G IP
Sbjct:  154 NNMFTGEIYNDIGVFSNLRVLDLGGNVLTGHVPGYLGNLSRLEFLTLASNQLTGGVPVEL----GKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIP 354          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.166e-16
Identity = 60/202 (29.70%), Postives = 89/202 (44.06%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKY------VYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N FYG IP  +G   SL ++D + N   G+IP A+ +    I  N    +        +Y+K + S             G+   ++SR                             + ++ N L+G+I  EIG +  L +L+L  NN +G IP  +  L  L +LDLS N L G+IP S  SLT L+   +  N+LTG IP
Sbjct:  460 NHFYGTIPHWIGKMESLFYIDFSNNTLTGAIPVAITELKNLIRLNGTASQMTDSSGIPLYVKRNKSSN-----------GLPYNQVSRFPPS-------------------------IYLNNNRLNGTILPEIGRLKELHMLDLSRNNFTGTIPDSISGLDNLEVLDLSYNHLYGSIPLSFQSLTFLSRFSVAYNRLTGAIP 625          

HSP 2 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 58/201 (28.86%), Postives = 90/201 (44.78%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPAL----FKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G +P E+     L  LDL+ NL +GS+   +      QS  I++N + GK        G    + + NL E   I  E  S        + +     G+    +N + S+  L I  N L+G +P  + S+  L  L+L  N LSG +   + +L GL  L +S NR    IP    +LT L  +D+ +N+ +G  P
Sbjct:   98 NQLKGEVPAEISKLEQLQVLDLSHNLLSGSVLGVVSGLKLIQSLNISSNSLSGKLSDVGVFPGLVMLNVSNNLFE-GEIHPELCSSSGGIQVLDLSMNRLVGNLDGLYNCSKSIQQLHIDSNRLTGQLPDYLYSIRELEQLSLSGNYLSGELSKNLSNLSGLKSLLISENRFSDVIPDVFGNLTQLEHLDVSSNKFSGRFP 297          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y3475_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.695e-16
Identity = 61/196 (31.12%), Postives = 93/196 (47.45%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP  L +  +L  L +N N   GSIP   F     +   F+       + +D S++     +L     +    + R          R+ G       N +  ++ LD+   ++SGSIP +IG++  L  L L  N LSGP+PT +G L  L  L L SNRL G IP+ + ++T+L  +DL  N   G++P
Sbjct:  269 NYFTGSIPTTLSNISTLERLGMNENNLTGSIPT--FGNVPNLKLLFLHTNS---LGSDSSRDLEFLTSLTNCTQLETLGIGR---------NRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVP 450          

HSP 2 Score: 72.7886 bits (177), Expect = 1.453e-12
Identity = 39/101 (38.61%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  290 GGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            GG   P+  +   ++ LD+  N   G+IP+E+G +S L  L++G N L GPIP  + +   L  L L SNRL G++PS + SLT L +++L  N + G +P
Sbjct:   79 GGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLP 179          

HSP 3 Score: 72.4034 bits (176), Expect = 1.897e-12
Identity = 59/193 (30.57%), Postives = 84/193 (43.52%), Query Frame = 2
Query:   17 GRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMF-LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G I P +G+   L+ LDL  N F G+IP  +                             G  + LE+  +    L     R P            P   +N S +  L +  N L GS+P E+GS++ L  LNL  NN+ G +PT +G+L  L  L LS N LEG IPS ++ LT +  + L  N  +G+ P
Sbjct:   80 GVISPSIGNLSFLVSLDLYENFFGGTIPQEV-----------------------------GQLSRLEYLDMGINYL-----RGPI-----------PLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFP 227          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: IMK2_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.825e-16
Identity = 65/227 (28.63%), Postives = 110/227 (48.46%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGS------KECHGAGNLLEFAGIRAERL-------SRISTRSPCNFTRVYGGHTQPTFNHN---GS----------MMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN   G IP  LG+C  L  LDL++N   G+IPP+L + +      ++ N + G   V +    +      +  + +G++ +F    +  L       +R S   P +  + +    + + +HN   GS          +  LD SYN ++G+IP    ++S L  LNL  N+L GPIP  +  L  L  L+L  N++ G IP ++ +++ + ++DL  N  TG IP
Sbjct:  151 NNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCK-HSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISGIKKLDLSENNFTGPIP 376          

HSP 2 Score: 71.2478 bits (173), Expect = 4.227e-12
Identity = 43/125 (34.40%), Postives = 69/125 (55.20%), Query Frame = 2
Query:  218 FAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +AGI+  R   ++ + P    +  GG         GS+  L +  N+++GS+P+ +G +  L  + L +N LSG IP  +G+   L  LDLSSN+L G IP S++  T L  ++L  N L+G +P
Sbjct:   86 WAGIKCLRGQVVAIQLPW---KGLGGTISEKIGQLGSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLP 207          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5020_ARATH (Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNS  G +P   GD +  + +DL++N F+G IP + F                                   FA +R+  LSR +   P  F R          N    M  LD+S N L+G +P +IG+M  + +LNL +N LSG +P+++  L GL  LDLS+N  +G IP+ + S  +    ++  N L+G+IP
Sbjct:  397 NNSVSGSLPSLWGDSQFSV-IDLSSNKFSGFIPVSFFT----------------------------------FASLRSLNLSRNNLEGPIPF-RGSRASELLVLNSYPQMELLDLSTNSLTGMLPGDIGTMEKIKVLNLANNKLSGELPSDLNKLSGLLFLDLSNNTFKGQIPNKLPSQMV--GFNVSYNDLSGIIP 555          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: HSL2_ARATH (LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.302e-16
Identity = 62/209 (29.67%), Postives = 100/209 (47.85%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNF-----TRV-------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NNSF G +P  LG    +   D++TN F+G +PP L  +  K+        +      +   +CH   N +  A       +++S   P  F     TR+         G   P+ +    +  L+IS N  SG IP ++  +  L +++L  N+  G IP+ +  L+ L  +++  N L+G IPSS+SS T L E++L  N+L G IP
Sbjct:  348 NNSFTGTLPRNLGKFSEISEFDVSTNRFSGELPPYLCYRR-KLQKIITFSNQLSGEIPESYGDCHSL-NYIRMAD------NKLSGEVPARFWELPLTRLELANNNQLQGSIPPSISKARHLSQLEISANNFSGVIPVKLCDLRDLRVIDLSRNSFLGSIPSCINKLKNLERVEMQENMLDGEIPSSVSSCTELTELNLSNNRLRGGIP 548          

HSP 2 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 65/207 (31.40%), Postives = 100/207 (48.31%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK---QSGKIAANFIVGKKYVYIKNDGSKECH------GAGNLLEFAGIRAERLSRISTRSPCNFTR-VYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IP   GDC SL ++ +  N  +G +P   ++      ++A N    +    I    SK  H       A N   F+G+   +L  +      + +R  + G      N   ++  +++  NML G IP  + S + L  LNL +N L G IP E+GDL  LN LDLS+N+L G IP+ +  L  LN+ ++  N+L G IP
Sbjct:  396 SNQLSGEIPESYGDCHSLNYIRMADNKLSGEVPARFWELPLTRLELANN---NQLQGSIPPSISKARHLSQLEISANN---FSGVIPVKLCDLRDLRVIDLSRNSFLGSIPSCINKLKNLERVEMQENMLDGEIPSSVSSCTELTELNLSNNRLRGGIPPELGDLPVLNYLDLSNNQLTGEIPAELLRLK-LNQFNVSDNKLYGKIP 595          

HSP 3 Score: 70.8626 bits (172), Expect = 5.521e-12
Identity = 55/214 (25.70%), Postives = 91/214 (42.52%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANF------------------IVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N+F G++P    + R L  L+L +NLF G IP +  + +     N                   +      YI  D S      GNL     +R    + +             G    +  +   +  LD++ N L+G IP+ IG +  ++ + L  N LSG +P  +G+L  L   D+S N L G +P  +++L L++  +L  N  TG +P
Sbjct:  133 NNFSGKLPEFSPEFRKLRVLELESNLFTGEIPQSYGRLTALQVLNLNGNPLSGIVPAFLGYLTELTRLDLAYISFDPSPIPSTLGNLSNLTDLRLTHSNLV-------------GEIPDSIMNLVLLENLDLAMNSLTGEIPESIGRLESVYQIELYDNRLSGKLPESIGNLTELRNFDVSQNNLTGELPEKIAALQLIS-FNLNDNFFTGGLP 332          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: EFR_ARATH (LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.231e-16
Identity = 62/198 (31.31%), Postives = 98/198 (49.49%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAE--RLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP  L +  SL   D+++N  +GSIP +     GK+   + +G +   + N+ S         LEF G  A   +L  +       + R+ G       N + ++  L +  N++SG+IP +IG++  L  L+L  N LSG +P   G L  L ++DL SN + G IPS   ++T L ++ L +N   G IP
Sbjct:  276 NQFTGAIPKTLANISSLERFDISSNYLSGSIPLSF----GKLRNLWWLGIRNNSLGNNSSSG-------LEFIGAVANCTQLEYLDV----GYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIP 458          

HSP 2 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 37/88 (42.05%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  329 MMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            + +L++SYN+L G IP  + + S L  ++L  N+L   +P+E+G L  L ILDLS N L G  P+S+ +LT L ++D   NQ+ G IP
Sbjct:  123 LQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIP 210          

HSP 3 Score: 74.7146 bits (182), Expect = 3.823e-13
Identity = 60/208 (28.85%), Postives = 91/208 (43.75%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKN-DGSKECHGAGNLLEFAGIRAERLSRISTRSPCNF-------TRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP ++G+  SL  L L TN+ +G +P +  K    Q   + +N I G+   Y  N    ++ H   N   F G   + L R      C +       T    G          S+ ++D+S N L+G  P+E+G +  L  L   +N LSG +P  +G    +  L +  N  +G IP  +S L  L  +D   N L+G IP
Sbjct:  379 NLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSN--SFHGRIPQSLGR------CRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIP-DISRLVSLKNVDFSNNNLSGRIP 577          

HSP 4 Score: 73.1738 bits (178), Expect = 1.112e-12
Identity = 53/186 (28.49%), Postives = 83/186 (44.62%), Query Frame = 2
Query:   35 LGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            + +C  L +LD+  N   G +P ++   S  + + F+ G+  +          H  GNL+    +  E             T +  G    +F    ++  +D+  N +SG IP   G+M+ L  L+L  N+  G IP  +G  R L  L + +NRL GTIP  +  +  L  IDL  N LTG  P
Sbjct:  340 VANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFL-GQNLI-----SGTIPHDIGNLVSLQELSLE-------------TNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFP 506          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5148_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g61480 OS=Arabidopsis thaliana GN=At5g61480 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.404e-15
Identity = 62/196 (31.63%), Postives = 90/196 (45.92%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G++PP LG    L  +++  N FNG+IP      S           KY  + N     C  +G+L +  G     LS + T     F   + G    ++++  S+  LD S N LSGSIP    ++  L  L+L  NNLSG +P  +G+L  L  L L +N   G +P  + S   L  +D+  N  TG IP
Sbjct:  211 NVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNL---------KYFDVSN-----CSLSGSLPQELG----NLSNLETLFL--FQNGFTGEIPESYSNLKSLKLLDFSSNQLSGSIPSGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTGVLPHKLGSNGKLETMDVSNNSFTGTIP 386          

HSP 2 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 59/207 (28.50%), Postives = 92/207 (44.44%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSK-----ECHGAGNLLE------FAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NS  G  P  + D   L  LD++ N F+ S PP + K       N         + +D S+     E +  G+  E      + G++  +   ++         V GG   P       +  ++I YN  +G+IP E   +S L   ++ + +LSG +P E+G+L  L  L L  N   G IP S S+L  L  +D  +NQL+G IP
Sbjct:  115 NSLEGSFPTSIFDLTKLTTLDISRNSFDSSFPPGISKLKFLKVFNAFSNNFEGLLPSDVSRLRFLEELNFGGSYFEGEIPAAYGGLQRLKFIHLA-------GNVLGGKLPPRLGLLTELQHMEIGYNHFNGNIPSEFALLSNLKYFDVSNCSLSGSLPQELGNLSNLETLFLFQNGFTGEIPESYSNLKSLKLLDFSSNQLSGSIP 314          

HSP 3 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 59/213 (27.70%), Postives = 90/213 (42.25%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVY---IKNDGSKEC-HGAGNLLE----------FAGIRAERLS---RISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP    + +SL  LD ++N  +GSIP           + F   K   +   I N+ S E   G G L E          F G+   +L    ++ T    N +  + G    +  H   +  L +  NM  G +PK +     L+     +N L+G IP   G LR L  +DLS+NR    IP+  ++  +L  ++L TN     +P
Sbjct:  283 NGFTGEIPESYSNLKSLKLLDFSSNQLSGSIP-----------SGFSTLKNLTWLSLISNNLSGEVPEGIGELPELTTLFLWNNNFTGVLPHKLGSNGKLETMDVSNNS--FTGTIPSSLCHGNKLYKLILFSNMFEGELPKSLTRCESLWRFRSQNNRLNGTIPIGFGSLRNLTFVDLSNNRFTDQIPADFATAPVLQYLNLSTNFFHRKLP 482          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
RLK5_ARATH7.444e-1733.67Receptor-like protein kinase 5 OS=Arabidopsis thal... [more]
PSKR1_ARATH7.444e-1730.61Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
Y2579_ARATH1.270e-1632.51Probably inactive leucine-rich repeat receptor-lik... [more]
PSKR2_ARATH2.166e-1629.70Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
Y3475_ARATH3.695e-1631.12Probable LRR receptor-like serine/threonine-protei... [more]
IMK2_ARATH4.825e-1628.63Probably inactive leucine-rich repeat receptor-lik... [more]
Y5020_ARATH6.302e-1630.96Probable inactive receptor kinase At5g10020 OS=Ara... [more]
HSL2_ARATH6.302e-1629.67LRR receptor-like serine/threonine-protein kinase ... [more]
EFR_ARATH8.231e-1631.31LRR receptor-like serine/threonine-protein kinase ... [more]
Y5148_ARATH1.404e-1531.63Probable leucine-rich repeat receptor-like protein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top