DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: DR100_ARATH (DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 2.395e-15
Identity = 62/196 (31.63%), Postives = 93/196 (47.45%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G IP E+G    L  L+L  N  +G IP +L           ++  K++ +  +G      A    +F  ++   LSR+             G    + +    +  LD+S N + G IP+ +G+M  L +LNL  N+L+GPIP  +    GL++ +LS N LEGTIP    S T L  +DL  N L+G IP
Sbjct:  145 NKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTS---------LIELKHLELTENGITGVIPA----DFGSLKM--LSRVLLGR-----NELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIP 320          

HSP 2 Score: 81.2629 bits (199), Expect = 4.085e-15
Identity = 41/100 (41.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            G   P      S+  LD++ N ++G IP EIG +S L +LNL  N +SG IP  +  L  L  L+L+ N + G IP+   SL +L+ + LG N+LTG IP
Sbjct:  125 GEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIP 224          

HSP 3 Score: 67.3958 bits (163), Expect = 6.104e-11
Identity = 33/78 (42.31%), Postives = 53/78 (67.95%), Query Frame = 2
Query:  359 LSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            ++G IP  I S++ L IL+L  N ++G IP E+G L  L +L+L+ N++ G IP+S++SL  L  ++L  N +TG+IP
Sbjct:  123 ITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIP 200          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.128e-15
Identity = 63/197 (31.98%), Postives = 89/197 (45.18%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMM-FLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N F G IP  LG    L +LDL+ N   G +P  LF+    ++       +  Y++            L  F              +P N T      T   +N   S+   + I  N L+G+IP E+G +  L IL L  NN SG IP E+ +L  L  LDLS+N L G IP S++ L  L+  ++  N L+G IP
Sbjct:  505 NRFVGTIPGWLGTLPDLFYLDLSDNFLTGELPKELFQLRALMSQKAYDATERNYLE------------LPVFV-------------NPNNVT------TNQQYNQLSSLPPTIYIKRNNLTGTIPVEVGQLKVLHILELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPWSLTGLHFLSYFNVANNTLSGPIP 670          

HSP 2 Score: 68.1662 bits (165), Expect = 3.578e-11
Identity = 66/216 (30.56%), Postives = 94/216 (43.52%), Query Frame = 2
Query:    2 NNSFYGRIPPE-LGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKND--------GSKECHGAGNLLEFA----GIRAERLSRISTRSPCNFTRV------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G +PP  L     L+ LDL+ N F G +P    +QS    +N I   + V + ++         S    GA NL  F            S + T SP   T++      + G      +    +  L   +N LSG IPKEI ++  L  L L  N LSG I   +  L  L +L+L SN +EG IP  +  L+ L+ + L  N L G IP
Sbjct:  125 HNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELP---LQQSFGNGSNGIFPIQTVDLSSNLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTASP-QLTKLDFSYNDFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIP 336          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1719_ARATH (Probable inactive receptor kinase At1g27190 OS=Arabidopsis thaliana GN=At1g27190 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.864e-15
Identity = 43/90 (47.78%), Postives = 57/90 (63.33%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGS-MSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            S+  LD+S N LSGSIP +I S + YL  L+L  N L G IPT++ + + LN L LS N+L G+IPS +S L  L  + L  N L+G IP
Sbjct:   97 SLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVECKFLNALILSDNKLSGSIPSQLSRLDRLRRLSLAGNDLSGTIP 186          

HSP 2 Score: 25.0238 bits (53), Expect = 3.864e-15
Identity = 17/51 (33.33%), Postives = 26/51 (50.98%), Query Frame = 3
Query:  111 SSNLVKLRLTLLWGR------SMCISRMMVAKSVME-LETCSSLQELELSG 242
            +S++ KL     W        S+ +  M +A  + E L+ C SLQ L+LSG
Sbjct:   55 ASSICKLTGVSCWNEKENRIISLQLQSMQLAGEIPESLKLCRSLQSLDLSG 105          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y3804_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.335e-15
Identity = 66/224 (29.46%), Postives = 99/224 (44.20%), Query Frame = 2
Query:    5 NSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK---QSGKIAANFIVGKK--------YVYIKNDGSKECHGA---GNLLEFAGIRAERLS--RISTRSPCNFTRVYG------------GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            N   G +P  L  C+ L+ + L  N F+G+IP   F    Q    + N + G             I+ D S         G +  F  +R   LS    +TR P     +              G        + S+  L +  N L+GSIP+ IG+ S L +L+L HNNL+GPIP  + +L+ L IL L +N+L G IP  +  L  L  +++  N+L G +P
Sbjct:  353 NKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDLGLQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLP 576          

HSP 2 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 58/221 (26.24%), Postives = 105/221 (47.51%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALF-------------KQSGKIAANFIVGKKYVYIKNDGSKECHGAGNL-----------LEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN   G  PP +GD   L+ LD ++N   G +P ++              K SG++  +    K+ + ++  G+     +GN+           ++F+G      + ++   P   +R++            S++ LD+S+N L+GSIP E+G   ++  LNL  N+ +  +P E+  L+ L +LDL ++ L G++P+ +     L  + L  N LTG IP
Sbjct:  304 NNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGN---DFSGNIPDGFFDLGLQEMDFSG------NGLTGSIPRGSSRLF-----------ESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIP 504          

HSP 3 Score: 76.2554 bits (186), Expect = 1.314e-13
Identity = 63/228 (27.63%), Postives = 102/228 (44.74%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKI-----AANFIVGK------KYVYIKNDGSKECHGAGNLLEFAGI-RAERLSRISTRS-------PCNFTRV------------YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N+  G+IP  LG   SL  LDL  N F+G++   LF     +     + N + G+      +   + +        +GN    +GI R ERL  +   S       P     +            + G           +  +D+S N  SG +P+ +  +  L   ++ +N LSG  P  +GD+ GL  LD SSN L G +PSS+S+L  L +++L  N+L+G +P
Sbjct:  133 HNNLSGQIPSSLGSITSLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNLSRNRFSGNPSFVSGIWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVP 360          

HSP 4 Score: 72.7886 bits (177), Expect = 1.453e-12
Identity = 60/209 (28.71%), Postives = 95/209 (45.45%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIP-----------PALFKQSGKIAANFIVGKKYVY-IKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G+IP  L  C  L  L+L+ N F+G+              AL   S  ++ +  +G   ++ +K    +    +G L    G+    L+R+   S       + G    T     S+   D+S N+LSG  P  IG M+ L  L+   N L+G +P+ + +LR L  L+LS N+L G +P S+ S   L  + L  N  +G IP
Sbjct:  182 HNHLEGQIPSTLFRCSVLNSLNLSRNRFSGNPSFVSGIWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGL-CPHLNRVDLSS-----NHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIP 384          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1634_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g63430 OS=Arabidopsis thaliana GN=At1g63430 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.188e-14
Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 2
Query:  353 NMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMI 589
            N+L G+IPKEIG++  L IL+LG+N+L GPIP E+G L G+ I++L SN L G +P+ + +L  L E+ +  N+L G +
Sbjct:  103 NILIGTIPKEIGNLKNLKILDLGNNHLMGPIPAEIGSLSGIMIINLQSNGLTGKLPAELGNLKYLRELHIDRNRLQGSL 181          

HSP 2 Score: 73.1738 bits (178), Expect = 1.112e-12
Identity = 42/109 (38.53%), Postives = 68/109 (62.39%), Query Frame = 2
Query:  266 PCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            PC++T +Y     P+ +H   ++ ++IS + + G +  E+G ++YL  L L  N L G IP E+G+L+ L ILDL +N L G IP+ + SL+ +  I+L +N LTG +P
Sbjct:   56 PCDWTGIY---CSPSKDH---VIKINISASSIKGFLAPELGQITYLQELILHGNILIGTIPKEIGNLKNLKILDLGNNHLMGPIPAEIGSLSGIMIINLQSNGLTGKLP 158          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5815_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150 OS=Arabidopsis thaliana GN=At5g58150 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 60/198 (30.30%), Postives = 87/198 (43.94%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHN-GSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F   +PPEL  CRSL+ +DL++N  N S+P                G  +  +K+         G+L+       E +     R   +  ++  GH      HN  S++ LD+S N   G I   + S   L  LNL  N        E+G L  L+ L+LS   L   IP  +S L+ L  +DL +N LTG +P
Sbjct:  170 NNDFQFGVPPELVHCRSLLSIDLSSNRLNESLPVGF-------------GSAFPLLKSLNLSRNLFQGSLIGVLHENVETVDLSENRFDGHILQLIPGH-----KHNWSSLIHLDLSDNSFVGHIFNGLSSAHKLGHLNLACNRFRAQEFPEIGKLSALHYLNLSRTNLTNIIPREISRLSHLKVLDLSSNNLTGHVP 349          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.516e-14
Identity = 37/89 (41.57%), Postives = 62/89 (69.66%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            ++ +L++  N ++G+IP+++G+++ L  L+L  NNLSGPIP+ +G L+ L  L L++N L G IP S++++  L  +DL  N LTG IP
Sbjct:   93 NLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIP 181          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 5.898e-14
Identity = 37/100 (37.00%), Postives = 62/100 (62.00%), Query Frame = 2
Query:  293 GHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            GH  P      ++ +L++  N ++G IP  +G+++ L  L+L  N+ SGPIP  +G L  L  L L++N L G+IP S++++T L  +DL  N+L+G +P
Sbjct:   83 GHLVPELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNNRLSGSVP 182          

HSP 2 Score: 70.4774 bits (171), Expect = 7.210e-12
Identity = 41/110 (37.27%), Postives = 59/110 (53.64%), Query Frame = 2
Query:  263 SPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +PC +  V       T N+  S++ +D+    LSG +  E+G +  L  L L  NN++GPIP+ +G+L  L  LDL  N   G IP S+  L+ L  + L  N LTG IP
Sbjct:   56 NPCTWFHV-------TCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIP 158          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: IMK3_ARATH (Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.704e-14
Identity = 62/217 (28.57%), Postives = 99/217 (45.62%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHG------AGNLLEFAGIRAERLSRISTR----------SPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN   G IP  LG    L  LDL+ NL +  IPP L   S      ++ N + G+  V +    S +         +G +L+  G ++  L  +S            S CN T++                    S+N + G++P E+  ++ L  +++  N++SG IP  +G++  L  LDLS N+L G IP S+S L  LN  ++  N L+G +P
Sbjct:  158 NNRLTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSSKLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPILDTWGSKSLNLRVLSLDHNSLSGPFPFSLCNLTQLQD---------------FSFSHNRIRGTLPSELSKLTKLRKMDISGNSVSGHIPETLGNISSLIHLDLSQNKLTGEIPISISDLESLNFFNVSYNNLSGPVP 359          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y4294_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.006e-13
Identity = 41/89 (46.07%), Postives = 55/89 (61.80%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            S+ FLD+S N+ S S+PKEIG    L  L+L  NN SG IP  +G L  L  LD+SSN L G +P S++ L  L  ++L +N  TG +P
Sbjct:  103 SLQFLDLSDNLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMP 191          

HSP 2 Score: 70.8626 bits (172), Expect = 5.521e-12
Identity = 59/212 (27.83%), Postives = 94/212 (44.34%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIP---PALFKQSG-KIAANFIVG-----------KKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            NN F G +        ++ +LDL+ N F GS P   P L + +   ++ N + G           K  V   +  S E    G LL    +    L                G+  P  +    +  LD+S+N   G +P   GS++ L +LNL  NNLSG +P+ + D+  L+ LD+S N   G +PS++SS  +    ++  N L+G +P
Sbjct:  372 NNQFEGNLT-RWSKWENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQNNGMT----------GNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLSGSLPSSMNDIVSLSSLDVSQNHFTGPLPSNLSSNIM--AFNVSYNDLSGTVP 570          

HSP 3 Score: 68.9366 bits (167), Expect = 2.098e-11
Identity = 58/223 (26.01%), Postives = 92/223 (41.26%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAG--IRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSM------------------------SYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +NS  G +P   G C   + LDL+ N F G               N     K+  I+     + H  G+  +     +RA  L+        ++ ++ G   +    H   +  LDIS N L G IP  + SM                        S + +L+L HN   G +P   G L  L +L+L++N L G++PSSM+ +  L+ +D+  N  TG +P
Sbjct:  351 SNSLTGELPLLTGGC---VLLDLSNNQFEG---------------NLTRWSKWENIEYLDLSQNHFTGSFPDATPQLLRANHLN-------LSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLSGSLPSSMNDIVSLSSLDVSQNHFTGPLP 548          

HSP 4 Score: 67.0106 bits (162), Expect = 7.972e-11
Identity = 35/94 (37.23%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  311 FNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            F++   ++ L +S N LSG +P ++GS   L  L+L  N  S  +P E+G    L  L LS N   G IP SM  L  L  +D+ +N L+G +P
Sbjct:   74 FSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLP 167          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
DR100_ARATH2.395e-1531.63DNA-damage-repair/toleration protein DRT100 OS=Ara... [more]
PSYR1_ARATH3.128e-1531.98Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]
Y1719_ARATH3.864e-1547.78Probable inactive receptor kinase At1g27190 OS=Ara... [more]
Y3804_ARATH5.335e-1529.46Probably inactive leucine-rich repeat receptor-lik... [more]
Y1634_ARATH1.188e-1446.84Probable LRR receptor-like serine/threonine-protei... [more]
Y5815_ARATH4.516e-1430.30Probably inactive leucine-rich repeat receptor-lik... [more]
BAK1_ARATH4.516e-1441.57BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
SERK1_ARATH5.898e-1437.00Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
IMK3_ARATH7.704e-1428.57Probable leucine-rich repeat receptor-like protein... [more]
Y4294_ARATH1.006e-1346.07Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top