DC900025

Overview
NameDC900025
Unique NameDC900025
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length592
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9720 contig Csv1_Contig9720:77..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y2165_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g16250 OS=Arabidopsis thaliana GN=At2g16250 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.314e-13
Identity = 39/102 (38.24%), Postives = 61/102 (59.80%), Query Frame = 2
Query:  287 YGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            + G    +F+   +++ LD+S N L+G IP  +G++S L  LN   N+ S PIP+E+GDL  L   DLS N L G++P  +  L+ L  + +G N L+G +P
Sbjct:  188 FTGVLPQSFSSLKNLLTLDVSSNYLTGPIPPGLGALSKLIHLNFSSNSFSSPIPSELGDLVNLVDFDLSINSLSGSVPQELRKLSKLQLMAIGDNLLSGTLP 289          

HSP 2 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  338 LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            LD+S   ++G +P  +G+++ L  LNL  N+L+  +P+ +G L  L+ LDLS N   G +P S SSL  L  +D+ +N LTG IP
Sbjct:  133 LDLSSCSVNGVVPFTLGNLTSLRTLNLSQNSLTSLVPSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLKNLLTLDVSSNYLTGPIP 217          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5457_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.716e-13
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  251 ISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            I++  PC +  V         +  G ++ L+++   LSG +   IG +++L  L L +N L+GPIP+E+G L  L  LDLS NR  G IP+S+  LT LN + L  N L+G +P
Sbjct:   62 INSVDPCTWNMV-------GCSSEGFVVSLEMASKGLSGILSTSIGELTHLHTLLLQNNQLTGPIPSELGQLSELETLDLSGNRFSGEIPASLGFLTHLNYLRLSRNLLSGQVP 168          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5332_ARATH (Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.927e-13
Identity = 36/89 (40.45%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            ++ FL +S N +SG+ P  + ++  L  L L  N  SGP+P+++     L +LDLS+NR  G+IPSS+  LTLL+ ++L  N+ +G IP
Sbjct:   91 NLRFLILSSNNISGTFPTTLQALKNLTELKLDFNEFSGPLPSDLSSWERLQVLDLSNNRFNGSIPSSIGKLTLLHSLNLAYNKFSGEIP 179          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5374_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.823e-13
Identity = 42/128 (32.81%), Postives = 70/128 (54.69%), Query Frame = 2
Query:  212 LEFAGIRAERLSRISTRSPCNFT-RVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +   G  A  L  +S  +  NF      G   P   +   ++FL +S N L+GS+P+E+GS+S L IL + +N +SG +PT + +L+ L    +++N + G IP   S+LT +    +  N+LTG +P
Sbjct:   87 MNLTGQLAPELGLLSNLTILNFMWNDLTGQIPPELGNLTHLIFLLLSGNQLTGSLPQELGSLSNLLILQIDYNEISGKLPTSLANLKKLKHFHMNNNSITGQIPPEYSTLTNVLHFLMDNNKLTGNLP 214          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y1699_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g69990 OS=Arabidopsis thaliana GN=At1g69990 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.823e-13
Identity = 40/90 (44.44%), Postives = 57/90 (63.33%), Query Frame = 2
Query:  326 SMMFLDISYNMLSGSIPKEIGS-MSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            S+  LD+S+N  SG IP +I S + YL  L+L  N LSG IP+++ D + LN L L+ N+L G+IPS ++ L  L  + L  N L+G IP
Sbjct:   90 SLQSLDLSFNDFSGLIPSQICSWLPYLVTLDLSGNKLSGSIPSQIVDCKFLNSLALNQNKLTGSIPSELTRLNRLQRLSLADNDLSGSIP 179          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.521e-13
Identity = 58/194 (29.90%), Postives = 94/194 (48.45%), Query Frame = 2
Query:    8 SFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSG----KIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQL 577
            +F G IP  +G+   L  L LN N F+G+IP ++ + S      IA N + GK  V   +DG+    G   LL+                     ++ G   +  F+   +++ +    N  +GSIP+ +G +  L +L L  N LSG IP+ + +L  L  L LS N+  G++P +++SLT L  +D+  N L
Sbjct:  128 AFNGPIPDSIGNLEQLTRLSLNLNKFSGTIPASMGRLSKLYWFDIADNQLEGKLPV---SDGAS-LPGLDMLLQTGHFHFGN------------NKLSGEIPEKLFSSEMTLLHVLFDGNQFTGSIPESLGLVQNLTVLRLDRNRLSGDIPSSLNNLTNLQELHLSDNKFTGSLP-NLTSLTSLYTLDVSNNPL 304          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y2242_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.517e-13
Identity = 71/228 (31.14%), Postives = 100/228 (43.86%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKI-----AANFIVGKKYVYIKNDGSKECHGAGNLLE--FAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNG-SMMFLDISYNMLSGSIPK-----------------------EIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N F   IP  L  C+SL+ +DL++N   GS+P        K+     A N I G+   +         + +GN  +    G+  E L  ++  S   F     GH     + N  S+++LD+S N LSG I                          I  +S L  LNL + NLSG IP E+  L  L+ LD+S N L G IP  + S+  L  ID+  N LTG IP
Sbjct:  172 HNGFQMSIPRGLLGCQSLVSIDLSSNQLEGSLPDGFGSAFPKLETLSLAGNKIHGRDTDFADMKSISFLNISGNQFDGSVTGVFKETLE-VADLSKNRFQ----GHISSQVDSNWFSLVYLDLSENELSGVIKNLTLLKKLKHLNLAWNRFNRGMFPRIEMLSGLEYLNLSNTNLSGHIPREISKLSDLSTLDVSGNHLAGHIP--ILSIKNLVAIDVSRNNLTGEIP 392          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RPKL_ARATH (Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.517e-13
Identity = 65/207 (31.40%), Postives = 94/207 (45.41%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFK----QSGKIAANFIVGKKYVYIKNDGSKECHGAGNLL-------EFAGIRAERLSRISTRSPCNFTR-VYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLN-ILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTG 583
            N    G I P+L     L  LDL++N FNGS+P ++F     QS  + +N + G        D  K  +   NL         F G     +S +   +  + ++  + G     F    +   LD+S N+L+GS+PK++G  S L  LNL HN + G I     +    N  +DLS N L G IPSS+S L    E   G  +L G
Sbjct:   88 NKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSG--------DLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFE---AAQILDLSSNLLNGSLPKDLGGKS-LHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCG 282          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: RPK2_ARATH (LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.453e-12
Identity = 54/170 (31.76%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  146 VGKKYVYIKNDGSKECHGA--GNLLE--------FAGIRAERLS-RI--STRSPCNFTRVYGGHTQPTFN-------HNGSMMFLDISYNMLSGSIPKEIGS-MSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +GK+  YI + G    +G   GNL +        +  +   +LS RI     + C   ++        F           S++ L++S+N L G IP  +G  M+ L  L++ +NNL+G IP   G L  L++LDLSSN L G IP    +L  L  + L  N L+G IP
Sbjct:  555 LGKRVSYIFSAGGNRLYGQFPGNLFDNCDELKAVYVNVSFNKLSGRIPQGLNNMCTSLKILDASVNQIFGPIPTSLGDLASLVALNLSWNQLQGQIPGSLGKKMAALTYLSIANNNLTGQIPQSFGQLHSLDVLDLSSNHLSGGIPHDFVNLKNLTVLLLNNNNLSGPIP 724          

HSP 2 Score: 67.3958 bits (163), Expect = 6.104e-11
Identity = 33/85 (38.82%), Postives = 52/85 (61.18%), Query Frame = 2
Query:  338 LDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            L + +N  SG IP  I  M  L +L+L  N ++G +P +   LR L +++L  NR+ G IP+S+ +LT L  ++LG N+L G +P
Sbjct:  149 LSLPFNSFSGEIPVGIWGMEKLEVLDLEGNLMTGSLPDQFTGLRNLRVMNLGFNRVSGEIPNSLQNLTKLEILNLGGNKLNGTVP 233          
BLAST of DC900025 vs. ExPASy Swiss-Prot
Match: Y5694_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.897e-12
Identity = 57/198 (28.79%), Postives = 83/198 (41.92%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNF-TRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIGSMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N F G +P  +G+C SL  L +  N F+G  P  L+K             +   I+ D ++          F G   E +S  S           + G          S+     S N  SG +P        L I+N+ HN L G IP E+ + + L  L L+ N   G IP S++ L +L  +DL  N LTG+IP
Sbjct:  302 SNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVLWKL-----------PRIKIIRADNNR----------FTGQVPESVSLASALEQVEIVNNSFSGEIPHGLGLVKSLYKFSASQNRFSGELPPNFCDSPVLSIVNISHNRLLGKIP-ELKNCKKLVSLSLAGNAFTGEIPPSLADLHVLTYLDLSDNSLTGLIP 477          

HSP 2 Score: 70.4774 bits (171), Expect = 7.210e-12
Identity = 56/198 (28.28%), Postives = 91/198 (45.96%), Query Frame = 2
Query:    2 NNSFYGRIPPELGDCRSLIWLDLNTNLFNGSIPPALFKQSGKIAANFIVGKKYVYIKNDGSKECHGAGNLLEFAGIRAERLSRISTRSPCNFTRVYGGHTQPTFNHNGSMMFLDISYNMLSGSIPKEIG-SMSYLFILNLGHNNLSGPIPTEVGDLRGLNILDLSSNRLEGTIPSSMSSLTLLNEIDLGTNQLTGMIP 592
            +N   G IP +LG   +L  L+L +NL  G +PPA             +GK    +  D S+  +    +  F G + ++L ++           + G    +F    S+  LD+S N LSG IP+ +G S+  L  L++  N LSG  P+ +   + L  L L SN  EG++P+S+     L  + +  N  +G  P
Sbjct:  156 SNHVEGMIPEDLGLLFNLQVLNLGSNLLTGIVPPA-------------IGKLSELVVLDLSENSYLVSEIPSFLG-KLDKLEQLLLHRSG-----FHGEIPTSFVGLTSLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFPSGICSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFP 334          
The following BLAST results are available for this feature:
BLAST of DC900025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
Y2165_ARATH1.314e-1338.24Probable LRR receptor-like serine/threonine-protei... [more]
Y5457_ARATH1.716e-1337.72Probable LRR receptor-like serine/threonine-protei... [more]
Y5332_ARATH2.927e-1340.45Probable inactive receptor kinase At5g53320 OS=Ara... [more]
Y5374_ARATH3.823e-1332.81Probable LRR receptor-like serine/threonine-protei... [more]
Y1699_ARATH3.823e-1344.44Probable LRR receptor-like serine/threonine-protei... [more]
Y5977_ARATH6.521e-1329.90Probable leucine-rich repeat receptor-like protein... [more]
Y2242_ARATH8.517e-1331.14Probable LRR receptor-like serine/threonine-protei... [more]
RPKL_ARATH8.517e-1331.40Receptor protein kinase-like protein At4g34220 OS=... [more]
RPK2_ARATH1.453e-1231.76LRR receptor-like serine/threonine-protein kinase ... [more]
Y5694_ARATH1.897e-1228.79Probably inactive leucine-rich repeat receptor-lik... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900025 VSS Citrus sinensis cDNA clone VS27Q33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900025 ID=DC900025|Name=DC900025|organism=Citrus sinensis|type=EST|length=592bp
CAACAACTCCTTTTATGGTAGGATCCCTCCGGAGCTTGGAGATTGTCGAA
GCTTGATATGGTTGGATCTTAATACCAACTTATTTAATGGATCCATCCCT
CCTGCATTGTTCAAGCAATCTGGTAAAATTGCGGCTAACTTTATTGTGGG
GAAGAAGTATGTGTATATCAAGAATGATGGTAGCAAAGAGTGTCATGGAG
CTGGAAACTTGCTCGAGTTTGCAGGAATTAGAGCTGAGCGGTTGAGCAGA
ATTTCCACCAGGAGCCCCTGCAACTTCACTAGAGTATATGGAGGTCACAC
TCAGCCTACATTTAACCATAATGGATCGATGATGTTTCTTGATATTTCGT
ACAACATGCTGTCGGGTAGCATTCCGAAGGAGATTGGTTCTATGTCATAT
CTTTTCATCTTGAATTTGGGCCATAACAATCTCTCCGGTCCTATTCCAAC
AGAGGTGGGAGACTTACGAGGTCTTAACATTCTTGACCTCTCGAGCAACA
GGCTTGAAGGGACAATTCCATCATCCATGAGTTCTCTTACGTTGCTTAAT
GAGATTGATCTGGGCACCAACCAACTCACTGGTATGATTCCT
back to top