DC900023

Overview
NameDC900023
Unique NameDC900023
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length607
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4068 contig Csv1_Contig4068:393..999. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LGMN_MOUSE (Legumain OS=Mus musculus GN=Lgmn PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 7.736e-41
Identity = 88/188 (46.81%), Postives = 126/188 (67.02%), Query Frame = 3
Query:    3 FLAVILGNRTALTG-GSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIG 563
            FLAV+ G+  A+ G GSGKV+ SGP D++FIY+ DHG+ G++  P  DDL+ KDL + ++  +E K Y+ MVFY+EACESGSM +  L +D+N+YA TA+ P ESSYA Y        +++  T LGD +S++W+EDS+  DL KETL +Q+ +V+  T       +SHVMQYGNK +S   +  + G
Sbjct:  115 FLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPN-DDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNH-LPDDINVYATTAANPKESSYACYY-------DEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT------NTSHVMQYGNKSISTMKVMQFQG 287          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LGMN_BOVIN (Legumain OS=Bos taurus GN=LGMN PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.940e-40
Identity = 87/188 (46.28%), Postives = 124/188 (65.96%), Query Frame = 3
Query:    3 FLAVILGNRTALTG-GSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIG 563
            FLAV+ G+  A+ G GSGKV+ SGP D++F+Y+ DHG+ G++  P  +DL+ KDL E ++  +E K Y+ MVFY+EACESGSM +  L  D+N+YA TA+ P ESSYA Y        ++   T LGD +S++W+EDS+  DL KETL +Q+ +V+  T       +SHVMQYGNK +S   +  + G
Sbjct:  113 FLAVLRGDAEAVKGVGSGKVLKSGPRDHVFVYFTDHGATGILVFPN-EDLHVKDLNETIRYMYEHKMYQKMVFYIEACESGSMMNH-LPPDINVYATTAANPRESSYACYY-------DEQRSTFLGDWYSVNWMEDSDVEDLTKETLHKQYQLVKSHT------NTSHVMQYGNKSISAMKLMQFQG 285          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LGMN_RAT (Legumain OS=Rattus norvegicus GN=Lgmn PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.549e-40
Identity = 85/188 (45.21%), Postives = 126/188 (67.02%), Query Frame = 3
Query:    3 FLAVILGNRTALTG-GSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIG 563
            FLAV+ G+  A+ G GSGKV+ SGP D++F+Y+ DHG+ G++  P  +DL+ KDL + ++  +E K Y+ MVFY+EACESGSM +  L +D+++YA TA+ P ESSYA Y        +++  T LGD +S++W+EDS+  DL KETL +Q+ +V+  T       +SHVMQYGNK +S   +  + G
Sbjct:  115 FLAVLRGDEEAVKGKGSGKVLKSGPRDHVFVYFTDHGATGILVFPN-EDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNH-LPDDIDVYATTAANPNESSYACYY-------DEERSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT------NTSHVMQYGNKSISTMKVMQFQG 287          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LGMN_HUMAN (Legumain OS=Homo sapiens GN=LGMN PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.117e-39
Identity = 87/188 (46.28%), Postives = 124/188 (65.96%), Query Frame = 3
Query:    3 FLAVILGNRTALTG-GSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIG 563
            FLAV+ G+  A+ G GSGKV+ SGP D++FIY+ DHGS G++  P  +DL+ KDL E +   ++ K Y+ MVFY+EACESGSM +  L +++N+YA TA+ P ESSYA Y        ++   T LGD +S++W+EDS+  DL KETL +Q+ +V+  T       +SHVMQYGNK +S   +  + G
Sbjct:  113 FLAVLRGDAEAVKGIGSGKVLKSGPQDHVFIYFTDHGSTGILVFP-NEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNH-LPDNINVYATTAANPRESSYACYY-------DEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT------NTSHVMQYGNKTISTMKVMQFQG 285          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LGMN_MACFA (Legumain OS=Macaca fascicularis GN=LGMN PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.906e-39
Identity = 86/188 (45.74%), Postives = 124/188 (65.96%), Query Frame = 3
Query:    3 FLAVILGNRTALTG-GSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIG 563
            FLAV+ G+  A+ G GSGKV+ SGP D++F+Y+ DHGS G++  P  +DL+ KDL E +   ++ K Y+ MVFY+EACESGSM +  L +++N+YA TA+ P ESSYA Y        ++   T LGD +S++W+EDS+  DL KETL +Q+ +V+  T       +SHVMQYGNK +S   +  + G
Sbjct:  113 FLAVLRGDAEAVKGIGSGKVLKSGPQDHVFVYFTDHGSTGILVFP-NEDLHVKDLNETIYYMYKHKMYRKMVFYIEACESGSMMNH-LPDNINVYATTAANPRESSYACYY-------DEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT------NTSHVMQYGNKTISTMKVMQFQG 285          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: LGMN_PONAB (Legumain OS=Pongo abelii GN=LGMN PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.613e-38
Identity = 85/188 (45.21%), Postives = 123/188 (65.43%), Query Frame = 3
Query:    3 FLAVILGNRTALTG-GSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIG 563
            FLAV+ G+  A+ G GSGKV+ SGP D++F+Y  DHGS G++  P  +DL+ +DL E +   ++ K Y+ MVFY+EACESGSM +  L +++N+YA TA+ P ESSYA Y        ++   T LGD +S++W+EDS+  DL KETL +Q+ +V+  T       +SHVMQYGNK +S   +  + G
Sbjct:  113 FLAVLRGDAEAVKGIGSGKVLKSGPQDHVFVYSTDHGSTGILVFP-NEDLHVEDLNETIHYMYKHKMYRKMVFYIEACESGSMMNH-LPDNINVYATTAANPRESSYACYY-------DEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHT------NTSHVMQYGNKTISTMKVMQFQG 285          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: HGLB_SCHJA (Hemoglobinase OS=Schistosoma japonicum GN=HAEM PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.046e-37
Identity = 86/194 (44.33%), Postives = 117/194 (60.31%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGTNPDTDT 584
            FL V+ G++ A     GKV+ SG ND +FIY+ DHG+ G++A P  DDL+AK  I  LK   + + Y  +V Y+EACESGSMF GLL  D+NIYA TA+ P ESSYA +C       +    +CL DL+S  WI DSEKH L + TL QQ+  V+  T +      SHV +YG+K++ K  +  + G+     T
Sbjct:  115 FLQVLKGDKRA----GGKVLKSGKNDDVFIYFTDHGAPGILAFPD-DDLHAKPFINTLKYLRQHRRYSKLVIYVEACESGSMFAGLLPTDINIYATTAARPDESSYATFC------DDPRISSCLADLYSYDWIVDSEKHQLTQRTLDQQYKEVKFETNL------SHVQRYGDKKMGKLYLSEFQGSRKKAST 291          
BLAST of DC900023 vs. ExPASy Swiss-Prot
Match: HGLB_SCHMA (Hemoglobinase OS=Schistosoma mansoni PE=1 SV=3)

HSP 1 Score: 143.665 bits (361), Expect = 7.014e-34
Identity = 77/188 (40.96%), Postives = 113/188 (60.11%), Query Frame = 3
Query:    3 FLAVILGNRTALTGGSGKVVNSGPNDYIFIYYADHGSAGMVAMPTGDDLYAKDLIEVLKKKHEAKSYKSMVFYLEACESGSMFDGLLTEDMNIYAVTASTPAESSYAMYCPGHYPSPEDDFETCLGDLFSISWIEDSEKHDLQKETLQQQHGVVRRRTLVDYLDFSSHVMQYGNKELSKEPIFTYIGT 566
            FL V+ G+++A     GKV+ SG ND +FIY+ DHG+ G++A P  D+LYAK+ +  LK  H  K Y  +V Y+EA ESGSMF  +L  +++IYA TA+   E SY+ +C       +    TCL DL+S +WI DS+ H L + TL QQ+  V+R T +      SHV +YG+  + K  +  + G+
Sbjct:  121 FLKVLKGDKSA----GGKVLKSGKNDDVFIYFTDHGAPGLIAFPD-DELYAKEFMSTLKYLHSHKRYSKLVIYIEANESGSMFQQILPSNLSIYATTAANSTECSYSTFC------GDPTITTCLADLYSYNWIVDSQTHHLTQRTLDQQYKEVKRETDL------SHVQRYGDTRMGKLYVSEFQGS 291          
The following BLAST results are available for this feature:
BLAST of DC900023 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
LGMN_MOUSE7.736e-4146.81Legumain OS=Mus musculus GN=Lgmn PE=1 SV=1[more]
LGMN_BOVIN2.940e-4046.28Legumain OS=Bos taurus GN=LGMN PE=1 SV=1[more]
LGMN_RAT6.549e-4045.21Legumain OS=Rattus norvegicus GN=Lgmn PE=2 SV=1[more]
LGMN_HUMAN1.117e-3946.28Legumain OS=Homo sapiens GN=LGMN PE=1 SV=1[more]
LGMN_MACFA1.906e-3945.74Legumain OS=Macaca fascicularis GN=LGMN PE=2 SV=1[more]
LGMN_PONAB1.613e-3845.21Legumain OS=Pongo abelii GN=LGMN PE=2 SV=1[more]
HGLB_SCHJA1.046e-3744.33Hemoglobinase OS=Schistosoma japonicum GN=HAEM PE=... [more]
HGLB_SCHMA7.014e-3440.96Hemoglobinase OS=Schistosoma mansoni PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900023 VSS Citrus sinensis cDNA clone VS27Q32 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900023 ID=DC900023|Name=DC900023|organism=Citrus sinensis|type=EST|length=607bp
ATTTTCTGGCGGTGATTCTCGGCAACAGAACTGCACTCACCGGGGGCAGT
GGCAAGGTTGTAAATAGTGGTCCGAATGACTATATTTTTATTTATTATGC
AGACCATGGAAGCGCTGGTATGGTCGCAATGCCTACTGGAGATGACCTCT
ACGCTAAAGATTTGATAGAGGTGTTAAAAAAGAAACACGAGGCTAAATCT
TATAAAAGCATGGTATTTTACCTTGAGGCTTGTGAATCCGGAAGCATGTT
TGATGGGCTTCTCACGGAAGACATGAACATATATGCAGTCACGGCTTCAA
CTCCCGCAGAGAGCAGCTACGCGATGTATTGTCCCGGGCATTATCCGAGT
CCCGAGGATGATTTTGAAACTTGTTTGGGTGATCTCTTCAGTATTTCTTG
GATTGAAGATAGTGAAAAACATGATTTACAGAAGGAAACACTACAGCAAC
AACATGGAGTGGTTCGGAGGAGGACATTGGTAGATTATTTAGACTTTAGC
TCTCATGTAATGCAGTACGGAAACAAAGAGCTGAGCAAAGAGCCAATTTT
TACGTATATTGGCACGAATCCTGATACCGACACCTTNACGATGAAGGCTG
AAGAATT
back to top