DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPA_BRAOT (Non-specific lipid-transfer protein A OS=Brassica oleracea var. italica GN=WAX9A PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.726e-31
Identity = 61/114 (53.51%), Postives = 86/114 (75.44%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSA-QAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSI-PSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP++A +A+TCG V+ ++APCIG++  GG +P  CC GV  LN+ ARTTPDRQ AC CL+ AAR++ P+LN   AAG+P ACGVS+P+ IST+T+C+ V+
Sbjct:    5 MKLACLVLACMIVAGPITANRALTCGTVNSNVAPCIGYITQGGTLPGACCTGVSKLNSMARTTPDRQQACRCLETAARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNVK 118          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_ARATH (Non-specific lipid-transfer protein 1 OS=Arabidopsis thaliana GN=LTP1 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.726e-31
Identity = 63/114 (55.26%), Postives = 87/114 (76.32%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPS-LNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP+++ A ++CG V+ +LA CIG++  GG IP  CC+GV++LN+ A+TTPDRQ ACNC++ AAR++ S LN   AAG+P ACGV+IPYKISTST+C  VR
Sbjct:    5 MKLACLLLACMIVAGPITSNAALSCGSVNSNLAACIGYVLQGGVIPPACCSGVKNLNSIAKTTPDRQQACNCIQGAARALGSGLNAGRAAGIPKACGVNIPYKISTSTNCKTVR 118          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 6.073e-31
Identity = 62/103 (60.19%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   31 MLVTGPLSAQAITCGQVSGSLAPCIGFLRS--GGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            +L T P +   +TCGQV+G+LAPC+G+LRS    P+P+ CCN VR LN AARTT D++TAC CLKQ A ++  LNLN AAGLP  CGV+IPYKIS +TDC++V
Sbjct:   17 VLATTPNAEAVLTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.932e-31
Identity = 66/111 (59.46%), Postives = 82/111 (73.87%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    VLCM+V  P  A+AITCGQV+ +LAPC+ +LR+ GP+   CC GV++L  +ARTT DRQ AC CLK AA +I  +NL  AAGLP  CGV+IPYKIS STDCSKV+
Sbjct:    6 KIACFVVLCMVVAAPC-AEAITCGQVTSNLAPCLAYLRNTGPLGR-CCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.036e-30
Identity = 57/91 (62.64%), Postives = 73/91 (80.22%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            ITCGQVS +LAPCI +++ GG +P  CCNG+R++N  ARTT DR+ ACNCLKQ + SIP +N NNAA LPG CGV++PYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPD_BRAOT (Non-specific lipid-transfer protein D OS=Brassica oleracea var. italica GN=WAX9D PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.308e-30
Identity = 62/114 (54.39%), Postives = 83/114 (72.81%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGP-IPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL      CM+V GP+++ A ++CG VSG +APCIG+L    P +P  CC+GV SLN  ARTTPDRQ AC CL  AA ++P++N+  AAGLP ACGV+IPYKIS +T+C+ V+
Sbjct:    5 MKLACLIFACMIVAGPITSNAALSCGTVSGYVAPCIGYLAQNAPAVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK 118          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_GERHY (Non-specific lipid-transfer protein OS=Gerbera hybrida PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 5.141e-30
Identity = 60/104 (57.69%), Postives = 74/104 (71.15%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            V CM+ +    A AI+CGQV+  L PC G+L +GGP+P  CCNGVR LN AA+TTPDRQTAC CLK    +   +NLNNA  LPG CG+SI YKI+ + DCSK+
Sbjct:   13 VACMVFSASY-ADAISCGQVTSGLVPCFGYLAAGGPVPPACCNGVRGLNNAAKTTPDRQTACGCLKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_PRUDU (Non-specific lipid-transfer protein 3 OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.333e-29
Identity = 64/116 (55.17%), Postives = 79/116 (68.10%), Query Frame = 1
Query:    1 LKLVS--AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNN--AAGLPGACGVSIPYKISTSTDCSKVR 336
            LKLV   A + CM V GP +  A++CGQV  +L PCI ++ +GG +   CC GVRSL + A+TT DRQ+ CNCLKQA   IP  N N   AAGLPG CGV+IPYKIS STDC  ++
Sbjct:    8 LKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSIK 123          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSJ (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. japonica GN=LTP PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.685e-29
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            A V  +L+  P +A AITCGQV+ ++ PC+ + R G      CC+GVRSL AAA TT DR+TACNCLK AAR I  LN  NAA +P  CGVS+PY IS S DCS+V
Sbjct:   10 ALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSI (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. indica GN=LTP PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.685e-29
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            A V  +L+  P +A AITCGQV+ ++ PC+ + R G      CC+GVRSL AAA TT DR+TACNCLK AAR I  LN  NAA +P  CGVS+PY IS S DCS+V
Sbjct:   10 ALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTPA_BRAOT2.726e-3153.51Non-specific lipid-transfer protein A OS=Brassica ... [more]
NLTP1_ARATH2.726e-3155.26Non-specific lipid-transfer protein 1 OS=Arabidops... [more]
NLTP_DAUCA6.073e-3160.19Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP1_TOBAC7.932e-3159.46Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP1_PRUDO1.036e-3062.64Non-specific lipid-transfer protein 1 OS=Prunus do... [more]
NLTPD_BRAOT2.308e-3054.39Non-specific lipid-transfer protein D OS=Brassica ... [more]
NLTP_GERHY5.141e-3057.69Non-specific lipid-transfer protein OS=Gerbera hyb... [more]
NLTP3_PRUDU3.333e-2955.17Non-specific lipid-transfer protein 3 OS=Prunus du... [more]
NLTP1_ORYSJ5.685e-2956.60Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP1_ORYSI5.685e-2956.60Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top