DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_TOBAC (Non-specific lipid-transfer protein 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 7.424e-29
Identity = 61/111 (54.95%), Postives = 80/111 (72.07%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    VLCM+V  P  A+A++CGQV   LAPC+ +L+  GP+   CC GV+ L  AA++  DR+TAC CLK AA +I  +++  AAGLPGACGV+IPYKIS STDCSKV+
Sbjct:    6 KIACFVVLCMVVVAP-HAEALSCGQVQSGLAPCLPYLQGRGPLGS-CCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_ARATH (Non-specific lipid-transfer protein 2 OS=Arabidopsis thaliana GN=LTP2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 9.696e-29
Identity = 61/114 (53.51%), Postives = 80/114 (70.18%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAI-TCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSI-PSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +KL    + CM+V GP++A A+ +CG V+G+LA CI +L  G P+   CCNGV +L   A TTPDRQ AC CL+ AA+++ P LN   AAGLP AC V+IPYKIS ST+C+ VR
Sbjct:    5 MKLACMVLACMIVAGPITANALMSCGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTVR 118          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_MAIZE (Non-specific lipid-transfer protein OS=Zea mays PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.266e-28
Identity = 62/110 (56.36%), Postives = 76/110 (69.09%), Query Frame = 1
Query:    7 LVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            + +A V  +L+    S  AI+CGQV+ ++APCI + R  G  P   CC+GVRSLN AARTT DR+ ACNCLK AA  +  LN  NAA +P  CGVSIPY ISTSTDCS+V
Sbjct:   10 VATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP2_SORBI (Non-specific lipid-transfer protein 2 OS=Sorghum bicolor GN=LTP2 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.654e-28
Identity = 61/109 (55.96%), Postives = 75/109 (68.81%), Query Frame = 1
Query:   10 VSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            V A    +++    S  A+TCGQVS ++ PC+ + R  G  P   CC+GVRSLN+AARTT DR+ ACNCLK AAR I  LN+  AA +P  CGVSIPY ISTSTDCS+V
Sbjct:   13 VVAAAAAVVLAATTSEAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRV 121          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_LENCU (Non-specific lipid-transfer protein 3 OS=Lens culinaris PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.160e-28
Identity = 59/107 (55.14%), Postives = 76/107 (71.03%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            A V+CM+V  P++  A++CG V+G LAPCI +L  G      CC GV+ L AAA TT DRQ ACNCLK AA +I +LN  NAA LPG C V+IPYKIST+T+C+ ++
Sbjct:   11 ALVMCMVVIAPMAEAAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTIK 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP4_ARATH (Non-specific lipid-transfer protein 4 OS=Arabidopsis thaliana GN=LTP4 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.821e-28
Identity = 60/113 (53.10%), Postives = 81/113 (71.68%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSI-PSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            L+  + +VL + +   + A AITCG V+ SL+PC+G+L  GG +P PCC GV+ LN  A+TTPDRQ AC CL+ AA+ + PSL    A+GLPG CGVSIPY ISTST+C+ ++
Sbjct:    5 LRFFTCFVLTVFIVASVDA-AITCGTVASSLSPCLGYLSKGGVVPPPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKGVNPSL----ASGLPGKCGVSIPYPISTSTNCATIK 112          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_SORBI (Non-specific lipid-transfer protein 1 OS=Sorghum bicolor GN=LTP1 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 4.812e-28
Identity = 63/112 (56.25%), Postives = 79/112 (70.54%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            + +V+A V+ +  T   S  AI+CGQVS ++A C+ + R  G  P   CC+GVRSLN+AARTT DR+ ACNCLK AAR I  LN  NAA +P  CGVS+PY ISTSTDCS+V
Sbjct:    8 IAVVAAVVVVLAAT--TSEAAISCGQVSSAIALCLSYARGQGFAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAARGISGLNAGNAASIPSKCGVSVPYTISTSTDCSRV 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLLC (Non-specific lipid-transfer protein 1 OS=Solanum lycopersicum GN=TSW12 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.208e-28
Identity = 59/111 (53.15%), Postives = 80/111 (72.07%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    +LCM+V  P  A+A+TCGQV+  LAPC+ +L+  GP+   CC GV++L  +A+TT DR+TAC CLK AA +I  ++LN AAG+P  C V+IPYKIS STDCS V+
Sbjct:    6 KIACFVLLCMVVVAP-HAEALTCGQVTAGLAPCLPYLQGRGPLG-GCCGGVKNLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_SOLPN (Non-specific lipid-transfer protein 1 OS=Solanum pennellii GN=LTP1 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.072e-27
Identity = 59/111 (53.15%), Postives = 79/111 (71.17%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            K+    +LCM+V  P  A+A+TCGQV+  LAPC+ +L+  GP+   CC GV+ L  +A+TT DR+TAC CLK AA +I  ++LN AAG+P  C V+IPYKIS STDCS V+
Sbjct:    6 KIACFVLLCMVVVAP-HAEALTCGQVTAGLAPCLPYLQGRGPLG-GCCGGVKGLLGSAKTTADRKTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_ARATH (Non-specific lipid-transfer protein 3 OS=Arabidopsis thaliana GN=LTP3 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.400e-27
Identity = 57/112 (50.89%), Postives = 79/112 (70.54%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            L+  +  VL + +   + A AI+CG V+GSLAPC  +L  GG +P  CC GV++LN+ A+TTPDRQ AC C++  A+SI  LN + A+GLPG CGVSIPY IS ST+C+ ++
Sbjct:    5 LRFFTCLVLTVCIVASVDA-AISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK 115          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP2_TOBAC7.424e-2954.95Non-specific lipid-transfer protein 2 OS=Nicotiana... [more]
NLTP2_ARATH9.696e-2953.51Non-specific lipid-transfer protein 2 OS=Arabidops... [more]
NLTP_MAIZE1.266e-2856.36Non-specific lipid-transfer protein OS=Zea mays PE... [more]
NLTP2_SORBI1.654e-2855.96Non-specific lipid-transfer protein 2 OS=Sorghum b... [more]
NLTP3_LENCU2.160e-2855.14Non-specific lipid-transfer protein 3 OS=Lens culi... [more]
NLTP4_ARATH2.821e-2853.10Non-specific lipid-transfer protein 4 OS=Arabidops... [more]
NLTP1_SORBI4.812e-2856.25Non-specific lipid-transfer protein 1 OS=Sorghum b... [more]
NLTP1_SOLLC8.208e-2853.15Non-specific lipid-transfer protein 1 OS=Solanum l... [more]
NLTP1_SOLPN1.072e-2753.15Non-specific lipid-transfer protein 1 OS=Solanum p... [more]
NLTP3_ARATH1.400e-2750.89Non-specific lipid-transfer protein 3 OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top