DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_PHAAU (Non-specific lipid-transfer protein 1 OS=Phaseolus aureus PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.548e-26
Identity = 51/90 (56.67%), Postives = 69/90 (76.67%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            +TCGQV G+LA CIGFL+ GG +P  CC GV+++  ++RTT DR+  C+CLK AA ++  +N NNA  LPG CGV+IPYKISTST+C+ +
Sbjct:    1 MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSI 90          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP5_ARATH (Non-specific lipid-transfer protein 5 OS=Arabidopsis thaliana GN=LTP5 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 2.022e-26
Identity = 61/114 (53.51%), Postives = 80/114 (70.18%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPS-LNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            LKL +  ++CMLVT P++++A I+CG V+GSL  C  +L  GG IP  CC+GV+ LN+ ARTT DRQ AC C++ AAR++ S LN   AA LPGAC V I Y IS  T+C+ VR
Sbjct:    5 LKLSTLVIVCMLVTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR 118          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP6_GOSHI (Non-specific lipid-transfer protein 6 OS=Gossypium hirsutum GN=LTP6 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.919e-25
Identity = 58/114 (50.88%), Postives = 70/114 (61.40%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP--CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            LKL    VLC+LV  PL+  AI+  QV  SL PC+G++R     P P   C G+RSL +AAR   DRQ AC C+K  A  I  +N   AAGLPG C V IPYKIS S DC +V+
Sbjct:    7 LKLACVVVLCLLVDAPLAQGAISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRVK 120          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_HORVU (Non-specific lipid-transfer protein 1 OS=Hordeum vulgare GN=LTP1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 4.980e-25
Identity = 54/110 (49.09%), Postives = 75/110 (68.18%), Query Frame = 1
Query:    7 LVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPM-PCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            L++A ++ ML   P +A A+ CGQV   + PC+ +++ GGP P   CCNGVR L+  A+++ DRQT CNCLK  AR I +LNLNNAA +P  C V++PY IS   DCS++
Sbjct:    8 LMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_VITSX (Non-specific lipid-transfer protein P3 OS=Vitis sp. PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.892e-24
Identity = 49/90 (54.44%), Postives = 65/90 (72.22%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            ++CG V+  +A CI +LR  GP+P  CCNGV++L  +A TT DR+TAC CL  A+++I  +N   AAGLP  CGVSIPYKIS ST+C +V
Sbjct:    1 LSCGDVATQMASCINYLRGAGPLPAACCNGVKNLKNSATTTQDRRTACKCLISASKTISGVNFGLAAGLPAKCGVSIPYKISPSTNCDQV 90          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_HORVU (Non-specific lipid-transfer protein 3 OS=Hordeum vulgare GN=LTP3 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 7.191e-24
Identity = 53/107 (49.53%), Postives = 73/107 (68.22%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLR-SGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            A V  ML+    +  AI+CGQVS +L+PCI + R +G   P+ CC+GV+ L  AA++T D+Q AC CLK  A SI  +N+   +G+PG CGVS+P+ IS STDC+KV
Sbjct:   13 AMVAAMLLVA--TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKV 117          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_ELECO (Non-specific lipid-transfer protein OS=Eleusine coracana PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 3.569e-23
Identity = 52/93 (55.91%), Postives = 64/93 (68.82%), Query Frame = 1
Query:   61 AITCGQVSGSLAPCIGFLRSGGPIPMPCC-NGVRSLNAAARTTPDRQTACNC-LKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            AI+CGQVS ++ PC+ + R  G  P   C +GVRSLNAAARTT DR+ ACNC LK AA  +  LN   A+ +PG CGV +PY IS S DCS+V
Sbjct:    1 AISCGQVSSAIGPCLAYARGAGAAPSASCQSGVRSLNAAARTTADRRAACNCSLKSAASRVSGLNAGKASSIPGRCGVRLPYAISASIDCSRV 93          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP4_ORYSJ (Non-specific lipid-transfer protein 4 OS=Oryza sativa subsp. japonica GN=Os12g0114500 PE=3 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 6.087e-23
Identity = 56/113 (49.56%), Postives = 74/113 (65.49%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP---CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            K V+A ++  L+    +A A+TCGQV   LAPCI +  + G +  P   CC+GVR+LN+AA TT DRQT C CLKQ   ++  L  +  AG+P  CGV+IPY IS STDCS+V
Sbjct:    8 KYVAAVMVVALLLAAPAASAVTCGQVVSMLAPCIMY--ATGRVSAPTGGCCDGVRTLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCGVNIPYAISPSTDCSRV 118          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLT42_HORVU (Non-specific lipid-transfer protein 4.2 OS=Hordeum vulgare GN=LTP4.2 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 7.951e-23
Identity = 54/108 (50.00%), Postives = 71/108 (65.74%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLR-SGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            A V  ML+    +  AI+CGQVS +L+PCI + R +G   P+ CC+GV+ L  AA++T D+Q AC C+K AA     LN   AAG+P  CGVS+PY IS S DCSK+R
Sbjct:   13 AMVAAMLIVA--TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAGG---LNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLT43_HORVU (Non-specific lipid-transfer protein 4.3 OS=Hordeum vulgare GN=LTP4.3 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.356e-22
Identity = 54/108 (50.00%), Postives = 71/108 (65.74%), Query Frame = 1
Query:   16 AWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLR-SGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            A V  ML+    +  AI+CGQVS +L+PCI + R +G   P+ CC+GV+ L  AA++T D+Q AC C+K AA     LN   AAG+P  CGVS+PY IS S DCSK+R
Sbjct:   13 AMVAAMLLVA--TDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAGG---LNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP1_PHAAU1.548e-2656.67Non-specific lipid-transfer protein 1 OS=Phaseolus... [more]
NLTP5_ARATH2.022e-2653.51Non-specific lipid-transfer protein 5 OS=Arabidops... [more]
NLTP6_GOSHI2.919e-2550.88Non-specific lipid-transfer protein 6 OS=Gossypium... [more]
NLTP1_HORVU4.980e-2549.09Non-specific lipid-transfer protein 1 OS=Hordeum v... [more]
NLTP3_VITSX1.892e-2454.44Non-specific lipid-transfer protein P3 OS=Vitis sp... [more]
NLTP3_HORVU7.191e-2449.53Non-specific lipid-transfer protein 3 OS=Hordeum v... [more]
NLTP_ELECO3.569e-2355.91Non-specific lipid-transfer protein OS=Eleusine co... [more]
NLTP4_ORYSJ6.087e-2349.56Non-specific lipid-transfer protein 4 OS=Oryza sat... [more]
NLT42_HORVU7.951e-2350.00Non-specific lipid-transfer protein 4.2 OS=Hordeum... [more]
NLT43_HORVU1.356e-2250.00Non-specific lipid-transfer protein 4.3 OS=Hordeum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top