DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLT41_HORVU (Non-specific lipid-transfer protein 4.1 OS=Hordeum vulgare GN=LTP4.1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.313e-22
Identity = 56/112 (50.00%), Postives = 71/112 (63.39%), Query Frame = 1
Query:   13 SAWVLCMLVTGPL---SAQAITCGQVSGSLAPCIGFLR-SGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            S  VL  LV   L   +  AI+CGQVS +L+PCI + R +G   P  CC+GV+ L  AA++T D+Q AC C+K AA     LN   AAG+P  CGVS+PY IS S DCSK+R
Sbjct:    7 SQLVLVALVAAMLLVAADAAISCGQVSSALSPCISYARGNGAKPPAACCSGVKRLAGAAQSTADKQAACKCIKSAAGG---LNAGKAAGIPSMCGVSVPYAISASVDCSKIR 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPC_ARATH (Non-specific lipid-transfer protein 12 OS=Arabidopsis thaliana GN=LTP12 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.946e-22
Identity = 47/110 (42.73%), Postives = 67/110 (60.91%), Query Frame = 1
Query:    4 KLVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            K+++  ++  +     +   I CG V+ +LA C+ +L + GP+P  CC GV+SL   A+TTPDR+  C CLK A + I  LN +  A LP  CGVSIPY IS ST+C  +
Sbjct:    6 KIITCLIVLTIYMASPTESTIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSI 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSJ (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. japonica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 6.731e-22
Identity = 47/105 (44.76%), Postives = 69/105 (65.71%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            V+   V    ++ A++CG V+ S+APC+ ++      P   CC+GVR+LN  A ++ DR+TAC+CLK  A S  +LN+ NAA +P  CGVS+ + ISTS DCSK+
Sbjct:   16 VVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI 120          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP3_ORYSI (Non-specific lipid-transfer protein 3 OS=Oryza sativa subsp. indica GN=LTP110-A PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 6.731e-22
Identity = 47/105 (44.76%), Postives = 69/105 (65.71%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            V+   V    ++ A++CG V+ S+APC+ ++      P   CC+GVR+LN  A ++ DR+TAC+CLK  A S  +LN+ NAA +P  CGVS+ + ISTS DCSK+
Sbjct:   16 VVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI 120          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_WHEAT (Non-specific lipid-transfer protein (Fragment) OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 8.790e-22
Identity = 51/110 (46.36%), Postives = 74/110 (67.27%), Query Frame = 1
Query:    7 LVSAWVLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPM-PCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            L++  ++ ML   P +A AI CG V   + PC+ +++ GGP P   CC+GV++L+  AR+  DRQ+ACNCLK  AR I +LN +NA  +P  CGV++PY IS + DCS+V
Sbjct:    5 LMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 113          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP7_ARATH (Non-specific lipid-transfer protein 7 OS=Arabidopsis thaliana GN=LTP7 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.658e-20
Identity = 52/116 (44.83%), Postives = 76/116 (65.52%), Query Frame = 1
Query:    1 LKLVSAWVLCMLVTGPLSAQA-ITCGQVSGSLAPCIGFLRSGG---PIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSI-PSLNLNNAAGLPGACGVSIPY--KISTSTDCS 327
            +KL     + ++  GP++A+A ++CG+V+ +L PC G+L +GG   P P  CCNGVR LN    TT DR+ AC C+K AAR++ P LN + AAG+P  CG+ IPY  +I  +T C+
Sbjct:    5 MKLGCLVFVFVIAAGPITAKAALSCGEVNSNLKPCTGYLTNGGITSPGPQ-CCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADRAAGIPRRCGIKIPYSTQIRFNTKCN 119          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP8_HORVU (Non-specific lipid-transfer protein Cw18 OS=Hordeum vulgare GN=CW18 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.227e-20
Identity = 46/92 (50.00%), Postives = 57/92 (61.96%), Query Frame = 1
Query:   61 AITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            AITCGQVS +L PC  + +  G  P   CC+GV+ L   AR+T D+Q  C CLK  A +    N   AAG+P  CGVS+PY IS S DCSK+
Sbjct:   26 AITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGAY---NAGRAAGIPSRCGVSVPYTISASVDCSKI 114          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPA_ARATH (Non-specific lipid-transfer protein 10 OS=Arabidopsis thaliana GN=LTP10 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.333e-19
Identity = 45/109 (41.28%), Postives = 63/109 (57.80%), Query Frame = 1
Query:   25 LCMLVTGPL---SAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAAR--SIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            LC+L+       S  AI+C  V  +L PC+ ++  GG IP  CCNG+R L+  A +  D+Q  C C+K      S  S+ L  AA LPG CGV +PYKI  ST+C+ ++
Sbjct:    8 LCLLLASIFAWGSEAAISCNAVQANLYPCVVYVVQGGAIPYSCCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSIK 116          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP6_ARATH (Non-specific lipid-transfer protein 6 OS=Arabidopsis thaliana GN=LTP6 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.333e-19
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = 1
Query:   25 LCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQA--ARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            +C+++       A++C  V   L PC+ ++  GGP+P  CCNG+ +L + A+T+ DRQ  C C+K A    ++    + NA  LP  CGV +PYK S STDC  ++
Sbjct:    8 VCLVLALHCGEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSIQ 113          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPB_ARATH (Non-specific lipid-transfer protein 11 OS=Arabidopsis thaliana GN=LTP11 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.647e-18
Identity = 48/105 (45.71%), Postives = 65/105 (61.90%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQAITCGQVSGSLAPCIGFLRSGG-PIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            V+ +L+      +AI C QV+  LA C+ +L++GG P PM CCNG+ SL AAA    DRQ ACNCLK  A +IP +N + A  LP  CGV+I    S + DC+ +
Sbjct:   15 VITILLGIAYHGEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVANTIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSI 118          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLT41_HORVU2.313e-2250.00Non-specific lipid-transfer protein 4.1 OS=Hordeum... [more]
NLTPC_ARATH3.946e-2242.73Non-specific lipid-transfer protein 12 OS=Arabidop... [more]
NLTP3_ORYSJ6.731e-2244.76Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP3_ORYSI6.731e-2244.76Non-specific lipid-transfer protein 3 OS=Oryza sat... [more]
NLTP1_WHEAT8.790e-2246.36Non-specific lipid-transfer protein (Fragment) OS=... [more]
NLTP7_ARATH1.658e-2044.83Non-specific lipid-transfer protein 7 OS=Arabidops... [more]
NLTP8_HORVU8.227e-2050.00Non-specific lipid-transfer protein Cw18 OS=Hordeu... [more]
NLTPA_ARATH5.333e-1941.28Non-specific lipid-transfer protein 10 OS=Arabidop... [more]
NLTP6_ARATH5.333e-1937.74Non-specific lipid-transfer protein 6 OS=Arabidops... [more]
NLTPB_ARATH2.647e-1845.71Non-specific lipid-transfer protein 11 OS=Arabidop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top