DC900015

Overview
NameDC900015
Unique NameDC900015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length557
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10926 contig Csv1_Contig10926:991..1547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_AMACA (Non-specific lipid-transfer protein OS=Amaranthus caudatus PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.457e-18
Identity = 44/94 (46.81%), Postives = 60/94 (63.83%), Query Frame = 1
Query:   61 AITCGQVSGSLAPCIGFLRSGGPIPMP--CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            A+TC  V+ +L PC+ +L+  G  P P  CC GVRSL AAA+T  DR+ ACNC+K AA+   SLN   AA L   CGV + Y +S + +C+ V+
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_AMAHP (Non-specific lipid-transfer protein 1 OS=Amaranthus hypochondriacus PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.457e-18
Identity = 44/94 (46.81%), Postives = 60/94 (63.83%), Query Frame = 1
Query:   61 AITCGQVSGSLAPCIGFLRSGGPIPMP--CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKVR 336
            A+TC  V+ +L PC+ +L+  G  P P  CC GVRSL AAA+T  DR+ ACNC+K AA+   SLN   AA L   CGV + Y +S + +C+ V+
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSVQ 94          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP1_HELAN (Non-specific lipid-transfer protein AP10 OS=Helianthus annuus PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 3.235e-16
Identity = 43/107 (40.19%), Postives = 61/107 (57.01%), Query Frame = 1
Query:   22 VLCMLVTGPLSAQ---AITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            +L M+V   L      AITC  V+G+L PC+ +LRSGG     CC G + L  A RT  DR+TAC C K AA  +  +  + A+ LPG CG+S    I+ + +C+ +
Sbjct:   10 ILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQL-KVRPDMASSLPGKCGISTSIPINPNVNCNTI 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPA_RICCO (Non-specific lipid-transfer protein A OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.577e-15
Identity = 40/91 (43.96%), Postives = 54/91 (59.34%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            + CGQV+ SLA CI FL  G   P   CC GV++L   A T+ DR+ AC C+K AA   P++  + A+ LP  CGV I   IS +T+C  +
Sbjct:    1 VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAI 91          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP_PINTA (Non-specific lipid-transfer protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 6.746e-14
Identity = 45/112 (40.18%), Postives = 61/112 (54.46%), Query Frame = 1
Query:    7 LVSAWVLCMLVTGPLSAQ-AITCGQVSGSLAPCIGFLRSGGPIPMP-CCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVS-IPYKISTSTDCSKV 333
            +V   V  M V G +  + AI+C QV  ++ PC  +L      P   CC  +R L++  + TPDRQ  CNCLK  A+S   + L  AA LPG C V+ +   IS + DCSKV
Sbjct:   12 VVGLVVTMMNVWGAVPVEGAISCNQVVSAMTPCATYLIGNAATPAATCCPSIRGLDSQVKATPDRQAVCNCLKTQAKSY-GVKLGKAANLPGLCKVTDLNVPISPNVDCSKV 122          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTP8_ARATH (Non-specific lipid-transfer protein 8 OS=Arabidopsis thaliana GN=LTP8 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.963e-13
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 1
Query:   52 SAQAITCGQVSGSLAPCIGFLRSG-GPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            S  AI+C  V   L PC+ +L SG G  P  CC+GV+SL AA  T+ D++ AC C+K  A S+ ++    A  L   CG S+P   S + DC+ V
Sbjct:   22 SESAISCSVVLQDLQPCVSYLTSGSGNPPETCCDGVKSLAAATTTSADKKAACQCIKSVANSV-TVKPELAQALASNCGASLPVDASPTVDCTTV 115          
BLAST of DC900015 vs. ExPASy Swiss-Prot
Match: NLTPB_RICCO (Non-specific lipid-transfer protein B OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.834e-12
Identity = 35/91 (38.46%), Postives = 52/91 (57.14%), Query Frame = 1
Query:   64 ITCGQVSGSLAPCIGFLRSGGPIP-MPCCNGVRSLNAAARTTPDRQTACNCLKQAARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV 333
            + CGQV+ +L+ C+ FL      P + CC GV  L   A T  D++ AC C+K AA   P++  + A+ LP  CGV I   IS +T+C ++
Sbjct:    1 VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAARYPNIREDAASSLPYKCGVVINVPISKTTNCHEI 91          
The following BLAST results are available for this feature:
BLAST of DC900015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP_AMACA3.457e-1846.81Non-specific lipid-transfer protein OS=Amaranthus ... [more]
NLTP1_AMAHP3.457e-1846.81Non-specific lipid-transfer protein 1 OS=Amaranthu... [more]
NLTP1_HELAN3.235e-1640.19Non-specific lipid-transfer protein AP10 OS=Helian... [more]
NLTPA_RICCO3.577e-1543.96Non-specific lipid-transfer protein A OS=Ricinus c... [more]
NLTP_PINTA6.746e-1440.18Non-specific lipid-transfer protein OS=Pinus taeda... [more]
NLTP8_ARATH1.963e-1341.05Non-specific lipid-transfer protein 8 OS=Arabidops... [more]
NLTPB_RICCO2.834e-1238.46Non-specific lipid-transfer protein B OS=Ricinus c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900015 VSS Citrus sinensis cDNA clone VS27Q25 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900015 ID=DC900015|Name=DC900015|organism=Citrus sinensis|type=EST|length=557bp
CTCAAGCTTGTTTCAGCTTGGGTTCTGTGCATGTTGGTGACTGGTCCCCT
GAGTGCTCAGGCCATAACATGTGGGCAGGTGAGTGGCTCATTGGCACCAT
GCATCGGTTTCTTGAGATCGGGCGGCCCTATACCTATGCCATGCTGCAAC
GGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACACCTGACCGCCAAAC
TGCATGCAACTGCTTGAAGCAAGCCGCCAGATCAATCCCTAGCCTCAACC
TTAATAATGCTGCTGGTCTTCCAGGAGCTTGTGGAGTCAGCATTCCTTAC
AAGATCAGCACCTCCACTGACTGCTCTAAGGTCAGGTGAACAGGAATCTG
GGCCGTTGATTTTCAGGTTTAAGTTGACGGAGTAGAATAAATGTATAATA
ATAAGGACATTTTTGTGTCCGATTTATGAGTCTCTCTCTACACTTTGTAC
TGCGAGTCTCGTTCGCGCCCTCGTTTCATGTTATGTTTTATTGGCTTTGC
TTTTCATGTCATCGGCAGNTTGGGTCTATTCTGGTTAATTAAATGAAATC
TTGCCTT
back to top