DC900012

Overview
NameDC900012
Unique NameDC900012
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length872
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2213 contig Csv1_Contig2213:433..1305. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL10_ARATH (GDSL esterase/lipase At1g28610 OS=Arabidopsis thaliana GN=At1g28610 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 1.634e-24
Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:  496 KYGFKE-PFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSYL 717
            K+GF + P  ACCG G P YNF +   CGS   K C +P +Y+NWDGVH+ EA YK ++D  L G ++ P F +L
Sbjct:  296 KFGFMDRPLPACCGLGGP-YNFTLSKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLLKGPYTIPSFHWL 369          

HSP 2 Score: 55.0694 bits (131), Expect = 1.634e-24
Identity = 37/133 (27.82%), Postives = 64/133 (48.12%), Query Frame = 2
Query:   86 SGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDT--IRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGI----GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            S   C+    +A   +GEIG ND+ +    + TS+   +  L I   ++ +  L+  G +  +V G    GC    + L    +++      GC+  +N+ S  +N  LQA+L  L + +P   I+Y DY+NA
Sbjct:  154 SPTDCRDMIGNAFIIMGEIGGNDFNFAFFVNKTSEVKELVPLVITKISSAIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEEYDPLTGCLTWLNDFSEYYNEKLQAELNRLSKLYPHVNIIYGDYFNA 286          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL8_ARATH (GDSL esterase/lipase At1g28590 OS=Arabidopsis thaliana GN=At1g28590 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.125e-24
Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  496 KYGF-KEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            K+GF   P  ACCG G   YNFN    CGS   + C +P QY+N+DG+H+ EA Y+++S+  L G ++ PPF +
Sbjct:  302 KFGFMNRPLPACCGVGGS-YNFNFSRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKW 374          

HSP 2 Score: 58.5362 bits (140), Expect = 2.125e-24
Identity = 47/161 (29.19%), Postives = 77/161 (47.83%), Query Frame = 2
Query:    5 ITPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGI----GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            IT  S+  QL  F + L +  C     S   C+   ++AL  +GEIG NDY + L        + +L    I + ++ +  L+  G +  +V G    G     + L    +++      GC+K +N+ S  +N  LQ +L  LR+ +P   I+YADY+NA
Sbjct:  137 ITNVSLSVQLRSFTESLPNL-C----GSPSDCRDMIENALILMGEIGGNDYNFALFQRKPVKEVEELVPFVIATISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYYNA 292          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL74_ARATH (GDSL esterase/lipase At5g03980 OS=Arabidopsis thaliana GN=At5g03980 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.963e-24
Identity = 56/162 (34.57%), Postives = 76/162 (46.91%), Query Frame = 2
Query:    8 TPQSIQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKL---AIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDR---DGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNAFPH 475
            TP S+Q  L WF   L S        S   C      +LF VGEIG NDY Y        + IR      + + T   + +++ GA  VVV G    GC P+ +   P  D    D  GC+  +N  +  HN  LQ  + +LR++FP   IVY DY+NAF +
Sbjct:   93 TPLSMQ--LAWFKGHLRST----CHGSSSDC---LKHSLFMVGEIGGNDYNYGFFQGKPMEEIRSYIPHVVGAITAAAREVIRAGAVNVVVPGNFPVGCFPIYLTSFPVKDTKDYDDNGCLTHLNEFAMDHNNQLQEAIASLRKEFPDVAIVYGDYYNAFQY 245          

HSP 2 Score: 50.8322 bits (120), Expect = 7.963e-24
Identity = 21/50 (42.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  520 KACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMS 669
            K+CCG+G   YN++     G+     C NP+++I+WDGVHL +  Y+ MS
Sbjct:  259 KSCCGTGGA-YNYDGKRPYGAVGVPVCQNPHKFISWDGVHLTQKAYRFMS 307          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL6_ARATH (GDSL esterase/lipase At1g28570 OS=Arabidopsis thaliana GN=At1g28570 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.960e-23
Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 1
Query:  496 KYGF-KEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFSY 714
            K+GF   P  ACC  G P +NF +    G+   + C +P +Y++WDGVH+ EA Y++M++  L G ++ PPF +
Sbjct:  300 KFGFISRPLPACCALGGP-FNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAIPPFDW 372          

HSP 2 Score: 62.3882 bits (150), Expect = 2.960e-23
Identity = 42/133 (31.58%), Postives = 70/133 (52.63%), Query Frame = 2
Query:   86 SGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLA---IPSFTNFLQALLKRGAKYVVVQGLPTTGCLP--LAMYLAPE-DDRDGI-GCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            S   C+   +++L  +GEIG NDY Y        + I++L    I + ++ +  L+  G K  +V G    GC    L++Y     ++ D + GC+K +N  S  H+  LQA+L  L++ +P   I+YADY+N
Sbjct:  157 SPSDCRDMIENSLILMGEIGGNDYNYAFFVGKNIEEIKELVPLVIETISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHVNIIYADYYN 289          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL22_ARATH (GDSL esterase/lipase At1g54790 OS=Arabidopsis thaliana GN=At1g54790 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.373e-21
Identity = 37/84 (44.05%), Postives = 49/84 (58.33%), Query Frame = 1
Query:  484 KIQGKYGFKEPFKACCGSGEPPYNFNVFATCG--------SPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPFS 711
            KI    GF++P  ACCG G  P N++   TCG        S +AKAC +  +YINWDG+H  EA  + +S   L+G +S PPFS
Sbjct:  314 KILNVLGFEKPLMACCGVGGAPLNYDSRITCGQTKVLDGISVTAKACNDSSEYINWDGIHYTEAANEFVSSQILTGKYSDPPFS 397          

HSP 2 Score: 46.2098 bits (108), Expect = 3.373e-21
Identity = 44/165 (26.67%), Postives = 68/165 (41.21%), Query Frame = 2
Query:    5 ITPQSIQTQLIWFNKF------LESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLKR----GAKYVVVQGLPTTGCLP--LAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            ++P S   Q+  F +F      L SK  ++ E   P     +   L+ + +IG ND A    S      +   +IPS     +A LKR    G + + +      GCL   +A +       D  GCV S N  +   NL L A     + Q+P A + Y D ++
Sbjct:  121 VSPFSFDLQISQFIRFKSRAIELLSKTGRKYEKYLPPIDY-YSKGLYMI-DIGQNDIAGAFYSKTLDQVLA--SIPSILETFEAGLKRLYEEGGRNIWIHNTGPLGCLAQNIAKFGTDSTKLDEFGCVSSHNQAAKLFNLQLHAMSNKFQAQYPDANVTYVDIFS 281          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL2_ARATH (GDSL esterase/lipase At1g09390 OS=Arabidopsis thaliana GN=At1g09390 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.397e-21
Identity = 31/69 (44.93%), Postives = 44/69 (63.77%), Query Frame = 1
Query:  499 YGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPP 705
            YGF++P  ACCG G PPYN+NV  TCG+  +K+C    ++I+WDG+H  E    +++   LS   S PP
Sbjct:  293 YGFEKPLMACCGYGGPPYNYNVNITCGNGGSKSCDEGSRFISWDGIHYTETANAIVAMKVLSMQHSTPP 361          

HSP 2 Score: 46.2098 bits (108), Expect = 4.397e-21
Identity = 41/159 (25.79%), Postives = 74/159 (46.54%), Query Frame = 2
Query:   11 PQSIQTQLIWFNKFLESKGCKEAESSGPQCQ-----AAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLK----RGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYW 460
            P ++  QL+ F  F +S+  + A  S P  +     + F +AL+ + +IG ND A +    ++   + KL IP+  + +++ +K     G +   V      GCLP  + +      D  GC+ + N  +   N  L    ++LR +  +A IVY D +
Sbjct:  125 PFALNIQLMQFLHF-KSRALELASISDPLKEMMIGESGFRNALYMI-DIGQNDIADSFSKGLSYSRVVKL-IPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVHSKGFDKHGCLATYNAAAKLFNEGLDHMCRDLRTELKEANIVYVDIY 280          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: LIP4_ARATH (GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana GN=LIP4 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.719e-21
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPP 705
            +YGFK P  ACCG G  PYN+NV  TCG   +  C    ++I+WDG+H  E    +++   LS  +S+PP
Sbjct:  295 QYGFKSPLMACCGYGGTPYNYNVKITCGHKGSNVCEEGSRFISWDGIHYTETANAIVAMKVLSMHYSKPP 364          

HSP 2 Score: 47.7506 bits (112), Expect = 5.719e-21
Identity = 42/159 (26.42%), Postives = 69/159 (43.40%), Query Frame = 2
Query:   11 PQSIQTQLIWFNKFLESKGCKEAESSGPQ-----CQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLKR----GAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYW 460
            P S+  Q+  F+ F +S+  + A SS            F +AL+ + +IG ND A +     +     KL IP     +++ +KR    G +   +      GCLP  + +    D D  GC+ S N+ +   N  L    + LR +   A I+Y D +
Sbjct:  128 PFSLNIQVKQFSHF-KSRSLELASSSNSLKGMFISNNGFKNALYMI-DIGQNDIARSFARGNSYSQTVKL-IPQIITEIKSSIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVKSKDLDQHGCLVSYNSAATLFNQGLDHMCEELRTELRDATIIYIDIY 283          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL61_ARATH (GDSL esterase/lipase At4g01130 OS=Arabidopsis thaliana GN=At4g01130 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.267e-19
Identity = 36/78 (46.15%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  499 YGFKEPFKACCGSGEPPYNFNVFATCG--------SPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPPF 708
            YG K   KACCG G  PYNFN    CG        S +AKAC +P+ Y++WDG+H  EA    +S   L G+ S PPF
Sbjct:  297 YGMKHGIKACCGYGGRPYNFNQKLFCGNTKVIGNFSTTAKACHDPHNYVSWDGIHATEAANHHISMAILDGSISYPPF 374          

HSP 2 Score: 41.5874 bits (96), Expect = 2.267e-19
Identity = 31/111 (27.93%), Postives = 44/111 (39.64%), Query Frame = 2
Query:  140 IGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLKR----GAKYVVVQGLPTTGCLP--LAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYAD 454
            IG ND+   L S        KL +P     +   +K     G +  +V  L   GC P  L  Y   + D D  GC+  VN     +N +L   L   R +   A ++Y D
Sbjct:  174 IGQNDFTSNLASIGVERV--KLYLPQVIGQIAGTIKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTDADLDKYGCLIPVNKAVKYYNTLLNKTLSQTRTELKNATVIYLD 282          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL60_ARATH (GDSL esterase/lipase At3g62280 OS=Arabidopsis thaliana GN=At3g62280 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.331e-17
Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  499 YGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRP 702
            YGF +P  ACCG G  P N++  ATCG P +  C +  + I WDGVH  EA  + + D  L+  +S P
Sbjct:  290 YGFVDPLMACCGYGGRPNNYDRKATCGQPGSTICRDVTKAIVWDGVHYTEAANRFVVDAVLTNRYSYP 357          

HSP 2 Score: 44.669 bits (104), Expect = 3.331e-17
Identity = 37/124 (29.84%), Postives = 54/124 (43.55%), Query Frame = 2
Query:  110 FDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFT----NFLQALLKRGAKYVVVQGLPTTGCLP--LAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            F +AL+ + +IG ND    L  S  +       IPS        +Q +   G +   V      GC P  LA++L  + D D IGC +  N  +   N  L +    LR QF  A +VY D ++
Sbjct:  156 FRNALYMI-DIGQNDLLLALYDSNLTYAPVVEKIPSMLLEIKKAIQTVYLYGGRKFWVHNTGPLGCAPKELAIHLHNDSDLDPIGCFRVHNEVAKAFNKGLLSLCNELRSQFKDATLVYVDIYS 278          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL54_ARATH (GDSL esterase/lipase At3g27950 OS=Arabidopsis thaliana GN=At3g27950 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.528e-16
Identity = 38/122 (31.15%), Postives = 64/122 (52.46%), Query Frame = 2
Query:  110 FDDALFWVGEIGVNDYAYTLGSSVTSDTIRK---LAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            F  AL+ + +IG ND A     ++T + ++    L I +FT  L+ L K GA++  +     TGCLP  +   P   RD  GC+K +NN +   N  L+ ++  L+++ P +   Y D ++A
Sbjct:  158 FSKALYTL-DIGQNDLAIGF-QNMTEEQLKATIPLIIENFTIALKLLYKEGARFFSIHNTGPTGCLPYLLKAFPAIPRDPYGCLKPLNNVAIEFNKQLKNKITQLKKELPSSFFTYVDVYSA 277          

HSP 2 Score: 41.9726 bits (97), Expect = 3.528e-16
Identity = 22/76 (28.95%), Postives = 35/76 (46.05%), Query Frame = 1
Query:  502 GFKEPFKACC--------GSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPP 705
            GF +PF  CC        G G+      +F       + +C N   +I+WDG+H  E    ++++  L G+ S PP
Sbjct:  289 GFIDPFDYCCVGAIGRGMGCGK-----TIFLNGTELYSSSCQNRKNFISWDGIHYTETANMLVANRILDGSISDPP 359          
The following BLAST results are available for this feature:
BLAST of DC900012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
GDL10_ARATH1.634e-2448.00GDSL esterase/lipase At1g28610 OS=Arabidopsis thal... [more]
GDL8_ARATH2.125e-2444.59GDSL esterase/lipase At1g28590 OS=Arabidopsis thal... [more]
GDL74_ARATH7.963e-2434.57GDSL esterase/lipase At5g03980 OS=Arabidopsis thal... [more]
GDL6_ARATH2.960e-2339.19GDSL esterase/lipase At1g28570 OS=Arabidopsis thal... [more]
GDL22_ARATH3.373e-2144.05GDSL esterase/lipase At1g54790 OS=Arabidopsis thal... [more]
GDL2_ARATH4.397e-2144.93GDSL esterase/lipase At1g09390 OS=Arabidopsis thal... [more]
LIP4_ARATH5.719e-2142.86GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana... [more]
GDL61_ARATH2.267e-1946.15GDSL esterase/lipase At4g01130 OS=Arabidopsis thal... [more]
GDL60_ARATH3.331e-1742.65GDSL esterase/lipase At3g62280 OS=Arabidopsis thal... [more]
GDL54_ARATH3.528e-1631.15GDSL esterase/lipase At3g27950 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900012 VSS Citrus sinensis cDNA clone VS27Q23 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900012 ID=DC900012|Name=DC900012|organism=Citrus sinensis|type=EST|length=872bp
TGACATTACTCCTCAGTCAATCCAAACTCAGCTCATTTGGTTCAACAAGT
TCTTGGAGAGCAAGGGATGTAAAGAAGCAGAGTCCTCAGGGCCTCAGTGC
CAGGCAGCTTTCGATGATGCATTGTTCTGGGTTGGTGAAATTGGAGTCAA
CGATTATGCGTACACTCTAGGATCTTCTGTTACAAGTGACACTATCCGAA
AACTCGCTATCCCTAGTTTTACAAATTTTCTGCAGGCGTTGCTTAAAAGA
GGAGCAAAATATGTTGTTGTTCAAGGTCTGCCGACAACAGGATGCTTGCC
GCTGGCAATGTATTTGGCCCCTGAAGACGATAGAGACGGTATAGGCTGTG
TAAAAAGTGTGAACAATCAAAGCTACACCCATAACCTTGTTCTTCAAGCC
CAATTACAGAATCTTAGACAGCAGTTTCCCCAGGCTGTGATTGTATATGC
TGATTACTGGAATGCTTTCCCGCATGGTGATGAAAAATCCAGGGGAAGTA
CGGGTTCAAGGAGCCCTTCAAGGCTTGCTGCGGATCCGGTGAACCTCCTT
ACAACTTTAATGTGTTTGCTACTTGTGGCTCGCCCTCTGCAAAAGCTTGC
CCGAATCCTTATCAATACATCAACTGGGACGGAGTTCATCTCNCTGAAGC
CATGTATAAGGTGATGAGTGACATGTTTCTTAGCGGAACATTTAGTCGCC
CTCCGTTCAGCTACTTACTGAGCAGAAAGCAGCGGGACGGATGAACCTCT
TGGTTATTGAAATTGGCTAANCAATANCAATGATTGTCTTTGAGCTCTGT
ATTATTATTTTTTTTTTCCNCTTTTCAAATATGGAGCCGTTAATCAACGG
TTTAAAATTTCCAGTGAACTTG
back to top