DC900012

Overview
NameDC900012
Unique NameDC900012
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length872
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2213 contig Csv1_Contig2213:433..1305. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL49_ARATH (GDSL esterase/lipase At3g05180 OS=Arabidopsis thaliana GN=At3g05180 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.064e-14
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPS--------AKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFS 696
            KYGF      CCG+G PP N++    CG  +        AK C +  +Y+NWDG+H  EA  + ++   L+G +S
Sbjct:  297 KYGFDHSIMVCCGTGGPPLNYDDQVGCGKTARSNGTIITAKPCYDSSKYVNWDGIHYTEAANRFVALHILTGKYS 371          

HSP 2 Score: 41.2022 bits (95), Expect = 1.064e-14
Identity = 34/116 (29.31%), Postives = 50/116 (43.10%), Query Frame = 2
Query:  137 EIGVNDYAYTLGSSVTSDTIRKLA-IPSFTNFLQALLKR----GAKYVVVQGLPTTGCLPLAMYLAPEDDR--DGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            +IG ND A   G+  T    + LA +P   +  Q  +KR    GA+   +      GCL   + +  ED    D  GCV   N  +   NL L    + L QQ+P +   Y D ++
Sbjct:  174 DIGQNDIA---GAFYTKTVDQVLALVPIILDIFQDGIKRLYAEGARNYWIHNTGPLGCLAQVVSIFGEDKSKLDEFGCVSDHNQAAKLFNLQLHGLFKKLPQQYPNSRFTYVDIFS 286          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL76_ARATH (GDSL esterase/lipase At5g14450 OS=Arabidopsis thaliana GN=At5g14450 PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.794e-14
Identity = 28/78 (35.90%), Postives = 37/78 (47.44%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPS--------AKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPP 705
            K GF  P K CCG  E   +      CG+            +CPNP   ++WDGVH  EA  K ++D  L+G  + PP
Sbjct:  306 KLGFANPLKVCCGYHEKYDHI----WCGNKGKVNNTEIYGGSCPNPVMAVSWDGVHYTEAANKHVADRTLNGLLTDPP 379          

HSP 2 Score: 47.7506 bits (112), Expect = 1.794e-14
Identity = 48/168 (28.57%), Postives = 74/168 (44.05%), Query Frame = 2
Query:    5 ITPQSIQTQLIWFNKF------LESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLK----RGAKYVVVQGLPTTGCLPLAMYL----APEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            I+P S+  Q+  F++F      L ++     +      Q  F  AL+   +IG ND +  +G    S    K  IP   N L + ++    +G +   V      GCLP+ M+     AP    D  GCVK+ N  +   N  L+  + NLR++  QA I Y D + A
Sbjct:  133 ISPFSLDMQIAQFDQFKARSALLFTQIKSRYDREKLPRQEEFAKALYTF-DIGQNDLS--VGFRTMSVDQLKATIPDIVNHLASAVRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGTPAP-GYLDKSGCVKAQNEMAMEFNRKLKETVINLRKELTQAAITYVDVYTA 296          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL86_ARATH (GDSL esterase/lipase At5g45960 OS=Arabidopsis thaliana GN=At5g45960 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.117e-14
Identity = 41/156 (26.28%), Postives = 73/156 (46.79%), Query Frame = 2
Query:   20 IQTQLIWFNKFLESKGCKEAESSGPQCQAAFDDALFWVGEIGVNDYA---YTLG---SSVTSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQ--AVIVYADYWN 463
            I TQL +F ++   K   E +    + +   ++A+F V   G ND+    +T+     + T +  ++  I +   F+Q L K GA+ + V GLP  GCLP+ + L   +      C+   +  +  +N +LQ QL  ++       + I Y D +N
Sbjct:  147 IPTQLEYFREY---KRKLEGKMGKQEMEKHIEEAMFCVSA-GTNDFVINYFTIPIRRKTFTIEAYQQFVISNLKQFIQGLWKEGARKITVAGLPPIGCLPIVITLFSGEALTNRRCIDRFSTVATNYNFLLQKQLALMQVGLAHLGSKIFYLDVYN 298          

HSP 2 Score: 43.1282 bits (100), Expect = 5.117e-14
Identity = 21/54 (38.89%), Postives = 29/54 (53.70%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMY 657
            K+GF+E F  CCGSG    +F     C +P +  CPN   Y+ +D +H  E  Y
Sbjct:  309 KFGFEEVFSGCCGSGYLEASF----LC-NPKSYVCPNTSAYVFFDSIHPSEKTY 357          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL1_ARATH (GDSL esterase/lipase At1g06990 OS=Arabidopsis thaliana GN=At1g06990 PE=2 SV=2)

HSP 1 Score: 50.447 bits (119), Expect = 5.123e-14
Identity = 31/114 (27.19%), Postives = 52/114 (45.61%), Query Frame = 2
Query:  143 GVNDYAYTLGSSVTS------DTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            G ND+   L  + +       D  +   + +  NF+Q L   G + ++V GLP  GCLP+ M +A +   +   C+   N+ S   N  L+  L  ++     +VI Y D + A
Sbjct:  174 GTNDFNLNLYDTPSRRQKLGVDGYQSFILSNVHNFVQELYDIGCRKIMVLGLPPVGCLPIQMTMAMQKQNER-RCIDKQNSDSQEFNQKLKNSLTEMQSNLTGSVIFYGDIYGA 286          

HSP 2 Score: 47.7506 bits (112), Expect = 5.123e-14
Identity = 22/58 (37.93%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMS 669
            +YG KE  + CCG+GE      +   C + + + CPNP QY+ WD +H  +  Y V+S
Sbjct:  296 RYGLKETTRGCCGTGE----IELAYLCNALT-RICPNPNQYLFWDDIHPSQIAYIVIS 348          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: EST_HEVBR (Esterase OS=Hevea brasiliensis PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 8.626e-14
Identity = 30/79 (37.97%), Postives = 37/79 (46.84%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAK---------ACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPP 705
            K+GF+ P   CCG G   YNF+V A CG              +C  P   +NWDG H  EA  +   D   +G FS PP
Sbjct:  295 KHGFEFPLITCCGYGGK-YNFSVTAPCGDTVTADDGTKIVVGSCACPSVRVNWDGAHYTEAANEYFFDQISTGAFSDPP 372          

HSP 2 Score: 41.9726 bits (97), Expect = 8.626e-14
Identity = 32/124 (25.81%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  110 FDDALFWVGEIGVNDYAYTLGSSVTSDTIRKL--AIPSFTNFLQALLKR----GAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            F+ AL+   +IG ND    L     + T+ ++   +P   N   A +K+    GA+   +      GCL   +   P  ++D  GC K+ N  +   N  L+  +  LR+  P A  V+ D ++
Sbjct:  166 FEKALYTF-DIGQND----LTEGFLNLTVEEVNATVPDLVNSFSANVKKIYDLGARTFWIHNTGPIGCLSFILTYFPWAEKDSAGCAKAYNEVAQHFNHKLKEIVAQLRKDLPLATFVHVDIYS 284          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL53_ARATH (GDSL esterase/lipase At3g26430 OS=Arabidopsis thaliana GN=At3g26430 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.121e-13
Identity = 28/79 (35.44%), Postives = 36/79 (45.57%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPS---------AKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFSRPP 705
            K GF+ P  ACCG G   YNFN    CG+           AK+C +    ++WDG+H  E     +      G FS PP
Sbjct:  294 KLGFRYPLVACCGHGGK-YNFNKLIKCGAKVMIKGKEIVLAKSCNDVSFRVSWDGIHFTETTNSWIFQQINDGAFSDPP 371          

HSP 2 Score: 45.4394 bits (106), Expect = 1.121e-13
Identity = 40/164 (24.39%), Postives = 71/164 (43.29%), Query Frame = 2
Query:    5 ITPQSIQTQLIWFNKFLESKGCKEAESSG-----PQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPS----FTNFLQALLKRGAKYVVVQGLPTTGCLPLAM--YLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            ++P S+  QL+ F+ F+                 P+ +  F  AL+   +IG ND    L  ++TSD I K  IP      +N ++ +  +G +   +      GCLP  +  +  P    D  GC    N  +  +N  L+ ++  LR++  +A   Y D ++
Sbjct:  123 VSPISLDVQLVQFSDFITRSQLIRNRGGVFKKLLPK-KEYFSQALYTF-DIGQNDLTAGLKLNMTSDQI-KAYIPDVHDQLSNVIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPASQIDNHGCAIPRNEIARYYNSELKRRVIELRKELSEAAFTYVDIYS 283          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: APG2_ARATH (GDSL esterase/lipase APG OS=Arabidopsis thaliana GN=APG PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.460e-13
Identity = 41/142 (28.87%), Postives = 65/142 (45.77%), Query Frame = 2
Query:   44 NKFLESKGCKEAES--SGPQCQAAFDDALFWVGEIGVNDYAYTLGSSVTSDTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            +K ++  G K+A+S   G  C  +   + F V    VN   Y +    T D      I +F+ F++ +   GA+ + V  LP TGCLP A  L    ++   GCV  +N  +   N  L A    L++Q+    IV  D ++
Sbjct:  142 SKLIKIAGSKKADSIIKGAICLLSAGSSDF-VQNYYVNPLLYKV---YTVDAYGSFLIDNFSTFIKQVYAVGARKIGVTSLPPTGCLPAARTLFGFHEK---GCVSRLNTDAQNFNKKLNAAASKLQKQYSDLKIVVFDIYS 276          

HSP 2 Score: 44.669 bits (104), Expect = 1.460e-13
Identity = 23/67 (34.33%), Postives = 30/67 (44.78%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFLSGTFS 696
            K GF E  K CCG+G           C   S   C N  QY+ WD VH  EA  ++++   +   FS
Sbjct:  287 KSGFTEATKGCCGTGTVE---TTSLLCNPKSFGTCSNATQYVFWDSVHPSEAANEILATALIGQGFS 350          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL78_ARATH (GDSL esterase/lipase At5g22810 OS=Arabidopsis thaliana GN=At5g22810 PE=2 SV=2)

HSP 1 Score: 46.9802 bits (110), Expect = 7.367e-12
Identity = 22/62 (35.48%), Postives = 31/62 (50.00%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMFL 681
            ++GF E  +ACCG+G           C   S   C N  +Y+ WDG H  EA  K+++D  L
Sbjct:  280 EFGFAEARRACCGTGL----LETSILCNPKSVGTCNNATEYVFWDGFHPTEAANKILADNLL 337          

HSP 2 Score: 43.8986 bits (102), Expect = 7.367e-12
Identity = 28/92 (30.43%), Postives = 46/92 (50.00%), Query Frame = 2
Query:  188 DTIRKLAIPSFTNFLQALLKRGAKYVVVQGLPTTGCLPLAM-YLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYW 460
            D    L I S+++F+Q L   GA+ + V  LP  GCLP A+  + P +     GC + +NN + + N  L    Q+L++      +V  D +
Sbjct:  181 DEFSDLLILSYSSFIQNLYSLGARRIGVTTLPPLGCLPAAITVVGPHEG----GCSEKLNNDAISFNNKLNTTSQDLKRNLIGLNLVVFDIY 268          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: EXL2_ARATH (GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana GN=EXL2 PE=2 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 9.537e-12
Identity = 22/61 (36.07%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSDMF 678
            +YGFK   K CCG+G       V   C + +A  CPN  +Y+ WD  H  E  Y++M+  +
Sbjct:  318 QYGFKVVDKGCCGTGL----IEVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKY 374          

HSP 2 Score: 41.9726 bits (97), Expect = 9.537e-12
Identity = 25/81 (30.86%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  224 NFLQALLKRGAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWNA 466
            +F Q L + GA+ + V G P  GC+P    LA    R+   CV   N+ +  +N+ L A L +L +      I+Y D +++
Sbjct:  231 SFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRN---CVVRFNDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDS 308          
BLAST of DC900012 vs. ExPASy Swiss-Prot
Match: GDL41_ARATH (GDSL esterase/lipase At2g30220 OS=Arabidopsis thaliana GN=At2g30220 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 9.554e-12
Identity = 26/59 (44.07%), Postives = 33/59 (55.93%), Query Frame = 1
Query:  496 KYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVHLXEAMYKVMSD 672
            KYGFKE  K CCG+G    +F     C S S K CPN   ++ WD +H  EA YK + +
Sbjct:  293 KYGFKETKKGCCGTGYLETSF----LCTSLS-KTCPNHSDHLFWDSIHPSEAAYKYLGN 346          

HSP 2 Score: 40.0466 bits (92), Expect = 9.554e-12
Identity = 29/101 (28.71%), Postives = 48/101 (47.52%), Query Frame = 2
Query:  194 IRKLAIPSFTNFLQALLKR-----------GAKYVVVQGLPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADYWN 463
            IR+L  P+   +   +LKR           G + ++V GLP  GCLP+ +  A      GI CV+  N  S  +N  L  +L  ++   P +  +YA+ ++
Sbjct:  184 IRRLEYPTIYGYQDFVLKRLDGFVRELYSLGCRNILVGGLPPMGCLPIQL-TAKLRTILGI-CVEQENKDSILYNQKLVKKLPEIQASLPGSKFLYANVYD 282          
The following BLAST results are available for this feature:
BLAST of DC900012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
GDL49_ARATH1.064e-1436.00GDSL esterase/lipase At3g05180 OS=Arabidopsis thal... [more]
GDL76_ARATH1.794e-1435.90GDSL esterase/lipase At5g14450 OS=Arabidopsis thal... [more]
GDL86_ARATH5.117e-1426.28GDSL esterase/lipase At5g45960 OS=Arabidopsis thal... [more]
GDL1_ARATH5.123e-1427.19GDSL esterase/lipase At1g06990 OS=Arabidopsis thal... [more]
EST_HEVBR8.626e-1437.97Esterase OS=Hevea brasiliensis PE=1 SV=1[more]
GDL53_ARATH1.121e-1335.44GDSL esterase/lipase At3g26430 OS=Arabidopsis thal... [more]
APG2_ARATH1.460e-1328.87GDSL esterase/lipase APG OS=Arabidopsis thaliana G... [more]
GDL78_ARATH7.367e-1235.48GDSL esterase/lipase At5g22810 OS=Arabidopsis thal... [more]
EXL2_ARATH9.537e-1236.07GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana ... [more]
GDL41_ARATH9.554e-1244.07GDSL esterase/lipase At2g30220 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900012 VSS Citrus sinensis cDNA clone VS27Q23 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900012 ID=DC900012|Name=DC900012|organism=Citrus sinensis|type=EST|length=872bp
TGACATTACTCCTCAGTCAATCCAAACTCAGCTCATTTGGTTCAACAAGT
TCTTGGAGAGCAAGGGATGTAAAGAAGCAGAGTCCTCAGGGCCTCAGTGC
CAGGCAGCTTTCGATGATGCATTGTTCTGGGTTGGTGAAATTGGAGTCAA
CGATTATGCGTACACTCTAGGATCTTCTGTTACAAGTGACACTATCCGAA
AACTCGCTATCCCTAGTTTTACAAATTTTCTGCAGGCGTTGCTTAAAAGA
GGAGCAAAATATGTTGTTGTTCAAGGTCTGCCGACAACAGGATGCTTGCC
GCTGGCAATGTATTTGGCCCCTGAAGACGATAGAGACGGTATAGGCTGTG
TAAAAAGTGTGAACAATCAAAGCTACACCCATAACCTTGTTCTTCAAGCC
CAATTACAGAATCTTAGACAGCAGTTTCCCCAGGCTGTGATTGTATATGC
TGATTACTGGAATGCTTTCCCGCATGGTGATGAAAAATCCAGGGGAAGTA
CGGGTTCAAGGAGCCCTTCAAGGCTTGCTGCGGATCCGGTGAACCTCCTT
ACAACTTTAATGTGTTTGCTACTTGTGGCTCGCCCTCTGCAAAAGCTTGC
CCGAATCCTTATCAATACATCAACTGGGACGGAGTTCATCTCNCTGAAGC
CATGTATAAGGTGATGAGTGACATGTTTCTTAGCGGAACATTTAGTCGCC
CTCCGTTCAGCTACTTACTGAGCAGAAAGCAGCGGGACGGATGAACCTCT
TGGTTATTGAAATTGGCTAANCAATANCAATGATTGTCTTTGAGCTCTGT
ATTATTATTTTTTTTTTCCNCTTTTCAAATATGGAGCCGTTAATCAACGG
TTTAAAATTTCCAGTGAACTTG
back to top